Recombinant Human Proto-Oncogene C-Fos (FOS) Protein (His&Myc)

Name: Recombinant Human Proto-Oncogene C-Fos (FOS) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-06214P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Proto-Oncogene C-Fos (FOS) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 85% as determined by SDS-PAGE.
Activity	Not tested.
Uniprotkb	P01100
Target Symbol	FOS
Synonyms	Cellular oncogene fos;Fos proto-oncogene, AP-1 transcription factor subunit;G0/G1 switch regulatory protein 7;Proto-oncogene c-Fos;Transcription factor AP-1 subunit c-Fos
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Expression Range	1-380aa
Protein Length	Full Length
Mol. Weight	45.7 kDa
Research Area	Epigenetics And Nuclear Signaling
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. In the heterodimer, FOS and JUN/AP-1 basic regions each seems to interact with symmetrical DNA half sites. On TGF-beta activation, forms a multimeric SMAD3/SMAD4/JUN/FOS complex at the AP1/SMAD-binding site to regulate TGF-beta-mediated signaling. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. In growing cells, activates phospholipid synthesis, possibly by activating CDS1 and PI4K2A. This activity requires Tyr-dephosphorylation and association with the endoplasmic reticulum.
Subcellular Location	Nucleus. Endoplasmic reticulum. Cytoplasm, cytosol. Note=In quiescent cells, present in very small amounts in the cytosol. Following induction of cell growth, first localizes to the endoplasmic reticulum and only later to the nucleus. Localization at the endoplasmic reticulum requires dephosphorylation at Tyr-10 and Tyr-30.
Protein Families	BZIP family, Fos subfamily
Database References	HGNC: 3796 OMIM: 164810 KEGG: hsa:2353 STRING: 9606.ENSP00000306245 UniGene: PMID: 29858576 gammadelta T cells suppressed iDCs osteoclastogenesis by downregulation of the RANK/cFos/ATP6V0D2 signaling pathway. PMID: 30066839 Mutant cellular AP-1 proteins promote expression of a subset of Epstein-Barr virus late genes in the absence of lytic viral DNA replication. PMID: 30021895 Low c-fos expression is associated with Oral Squamous Cell Carcinoma. PMID: 29582647 Study demonstrated that c-Fos was highly expressed in most of ovarian epithelial carcinoma cases and was significantly correlated with Lewis y. Also, the results revealed that c-Fos interacted with the FUT1 promoter. Silencing of c-Fos prevented TGF-beta1-induced Lewis y expression. PMID: 29130097 These findings indicate that the c-Fos/miR-22/MDC1 axis plays a relevant role in DNA repair in terminally differentiated cells, which may facilitate our understanding of molecular mechanism underlying the downregulating DNA repair in differentiated cells. PMID: 28637007 our results strongly suggest a novel role of c-Fos as a regulator of epithelial-mesenchymal transition and cancer stem cell(CSC) reprogramming in Head and neck squamous cell carcinoma (HNSCC)cells, which may hold potential as a CSC-directed therapeutic approach to improve HNSCC treatment PMID: 27965308 High c-fos expression is associated with malignant glioma. PMID: 27602752 Immunohistochemistry was employed to analyze cFos, cJun and CD147 expression in 41 UCB cases and 34 noncancerous human bladder tissues. PMID: 28358415 data enforced the evidence that knockdown of c-Fos inhibited cell proliferation, migration, and invasion, and promoted the apoptosis of OS cells accompanied by altered expression of Wnt2 and Fzd9 PMID: 28665975 These findings demonstrate an essential role for the ERK pathway together with c-JUN and c-FOS in the differentiation activity of LukS-PV. PMID: 27102414 novel function of KDM2B in the negative regulation of cell proliferation by assembling an E3 ligase to targeting c-Fos protein degradation that is antagonized by mitogenic stimulations PMID: 26725323 NF-Y Binding Site Architecture Defines a C-Fos Targeted Promoter Class PMID: 27517874 c-fos underexpression is associated with Myelodysplastic Syndrome. PMID: 27513856 miR-101 is downregulated in bladder cancer cells and has an inhibitory role in the regulation of bladder cancer cell proliferation and invasion via directly targeting c-FOS. PMID: 27485165 We found that c-jun or c-fos was significantly associated with lymph node metastasis, and coexpression of c-jun/c-fos, or c-jun/c-fos/p53 were significantly associated with lymph node metastasis, poor differentiation and clinical stage. PMID: 27558649 CRAC channel blockade also suppressed Oxo-M-induced c-fos and interleukin-2 expression PMID: 27474128 The results indicate that 17beta-estradiol-induced endometrial stromal cell invasion is dependent on c-fos-mediated MMP-9 expression. PMID: 26917263 FOS is a downstream effector of high glucose stimulation in peritoneal mesothelial cells that contributes to TGF-beta1 production. PMID: 26018137 VEGF-induced endothelial migration is mediated primarily by induction of JunB whereas the promotion of endothelial proliferation by VEGF is mediated by JunB-independent AP-1 family members. PMID: 26860974 c-Fos can protect against HDAC3 neurotoxicity. PMID: 25592718 These results indicate that IL-17A enhances COX2 expression and PGE2 production via the p38/c-Fos and JNK/c-Jun signalling pathways in NP cells to mediate intervertebral disc inflammation. PMID: 26988982 the results of this study suggest that FOS is among the candidate genes of schizophrenia and that changes in the expression of c-Fos protein may contribute to molecular mechanisms of schizophrenia-related alterations in synaptic plasticity. PMID: 25706621 Increased c-Fos expression is through TRPM3-mediated stimulation of the c-Fos promoter. PMID: 26493679 A novel AP-1 binding site at -1363 bp of the human TF promoter region was identified. PMID: 26631725 Simultaneous high expression of ID1 and c-Jun or c-Fos was correlated with poor survival in esophageal squamous cell carcinoma patients. PMID: 26858249 miR-146a has a role in targeting Fos expression in human cardiac cells PMID: 26112171 The translocation causes truncation of the FOS protein, with loss of the transactivation domain, which is thereby a novel mechanism involved in tumorigenesis. PMID: 26173738 ERK1 and ERK2 regulated the expression of c-Fos and c-Jun proteins in human cervical cancer cells. PMID: 25647783 O-GlcNAcylation of MLL5beta at T440 residue is critical for MLL5 recruitment to the HPV16/18-long control region through its interaction with AP-1. PMID: 25670814 The RNA binding complexes NF45-NF90 and NF45-NF110 associate dynamically with the c-fos gene and function as transcriptional coactivators. PMID: 26381409 Data show that interleukin-1 receptor type 2 (IL1R2) forms a complex with c-Fos proto-oncogene protein and activates the interleukin-6 (IL-6) and vascular endothelial growth factor A (VEGF-A) promoters. PMID: 26209639 Data indicate that deregulation of transcription factor AP-1 and microRNA-21-mediated axis led to an enhanced cell growth in hepatocellular carcinoma (HCC). PMID: 25544773 These results establish c-Fos homodimers as a novel form of the AP-1 complex that may be an autonomous transcription factor in c-Fos-overexpressing tissues and could contribute to tumor development. PMID: 26303532 Endoplasmic reticulum stress activates the hepatic AP-1 complex via MAPK-dependent signaling pathways. PMID: 25077945 co-expression of c-Fos or Fra1 was able to cooperate with TAp73 in potentiating cellular growth, similarly to c-Jun. These data together suggest that TAp73 plays a vital role in activation of AP-1 target genes via direct binding to c-Jun PMID: 26018080 The light-induced FOS response in melanopsin expressing HEK-293 cells is correlated with melanopsin quantity and dependent on light duration and irradiance. PMID: 24909488 c-Fos promotes the progression of viral transcription from early to late stages and accelerates viral lytic replication upon sustained ORF45-ERK-RSK activation during the Kaposi's Sarcoma-Associated Herpesvirus lytic life cycle. PMID: 25903346 By targeting the proto-oncogene Fos, miR-101 is involved in G1-to-S phase transition in cervical cancer cells in vitro. PMID: 24987920 Data suggest that p38 MAP kinase regulates c-Fos/cellular oncogene fos mRNA stability/decay by affecting state of phosphorylation of ELAVL1/HuR (Hu antigen R). PMID: 25588078 CDK12 plays an important role in cotranscriptional processing of c-FOS transcripts PMID: 25384976 We found significant negative correlations regarding the expression of the genes COMT, MAOB, DRD4, DRD5 and FOS, indicating that increased schizotypy coincides with higher levels of dopaminergic dysregulation on the mRNA-level. PMID: 24630741 results support the proposal that cooperative signaling of both NF-kappaB and AP1 (via p38alpha) amplifies STIM1 expression in ECs and, thereby, contributes to the lung vascular hyperpermeability response during sepsis PMID: 25016017 SMAR1 has a role in repressing c-Fos-mediated HPV18 E6 transcription through alteration of chromatin histone deacetylation PMID: 25157104 This study indicates that increased expression of c-Fos, p-c-Jun, members of AP-1 transcriptional factor and p-JNK is associated with neuronal degeneration in the ganglion cell layer of retinas in diabetic patients. PMID: 24073601 S100A4, FOS and CXCR4, playing a major role in tumor progression and metastasis, are downregulated by sorafenib. PMID: 24378831 the IL-1beta/p38/AP-1(c-fos)/MMP2 & MMP9 pathway play an important role in metastasis in gastric adenocarcinoma PMID: 24479681 the distinct requirement of NF-kappaB for mouse and human c-fos regulation PMID: 24386331 c-Fos, a well known AP-1 transcription factor, has emerged as a unique protein with the capacity to associate to specific enzymes of the pathway of synthesis of phospholipids at the endoplasmic reticulum and activate their synthesis. (Review) PMID: 24886961 Inflammation mediators act through c-Fos to increase VEGF production in peritoneal mesothelium. PMID: 23760290

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.