Recombinant Human Protein Wnt-7B (WNT7B) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-03979P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Protein Wnt-7B (WNT7B) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-03979P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Protein Wnt-7B (WNT7B) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P56706 |
| Target Symbol | WNT7B |
| Synonyms | Protein Wnt-7b; Wingless related MMTV integration site 7B; Wingless type MMTV integration site family member 7B; WNT; WNT7B; WNT7B_HUMAN |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His-SUMO&C-Myc |
| Target Protein Sequence | ALSSVVALGANIICNKIPGLAPRQRAICQSRPDAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNARRLMNLHNNEAGRKVLEDRMQLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK |
| Expression Range | 25-349aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 56.3kDa |
| Research Area | Stem Cells |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Ligand for members of the frizzled family of seven transmembrane receptors that functions in the canonical Wnt/beta-catenin signaling pathway. Required for normal fusion of the chorion and the allantois during placenta development. Required for central nervous system (CNS) angiogenesis and blood-brain barrier regulation. |
| Subcellular Location | Secreted, extracellular space, extracellular matrix. Secreted. |
| Protein Families | Wnt family |
| Database References | HGNC: 12787 OMIM: 601967 KEGG: hsa:7477 STRING: 9606.ENSP00000341032 UniGene: PMID: 28171582 |
