Recombinant Human Protein S100-A6 (S100A6) Protein (His-SUMO)

Name: Recombinant Human Protein S100-A6 (S100A6) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-09952P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Protein S100-A6 (S100A6) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P06703
Target Symbol	S100A6
Synonyms	2A9; 5B10; CABP; CACY; Calcyclin; Growth factor inducible protein 2A9; Growth factor-inducible protein 2A9; MLN 4; MLN4; OTTHUMP00000015472; OTTHUMP00000015473; PRA; PRAGrowth factor inducible protein 2A9; Prolactin receptor associated protein; Prolactin receptor-associated protein; Protein S100 A6; Protein S100-A6; S100 A6; S100 calcium binding protein A6 (calcyclin); S100 calcium binding protein A6; S100 calcium-binding protein A6; S100A6; S10A6_HUMAN
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
Expression Range	1-90aa
Protein Length	Full Length
Mol. Weight	26.2kDa
Research Area	Epigenetics And Nuclear Signaling
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.
Subcellular Location	Nucleus envelope. Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side.
Protein Families	S-100 family
Database References	HGNC: 10496 OMIM: 114110 KEGG: hsa:6277 STRING: 9606.ENSP00000357708 UniGene: PMID: 29746588 High expression of S100A6 in ICC defines a special group of patients with worse clinical characteristics and outcomes. Besides, S100A6 may promote ICC proliferation via activating p38/MAPK pathway. PMID: 28984474 The results suggest that binding of S100A6 to integrin beta1 affects cell adhesion/proliferation due to activation of ILK and FAK signaling pathways. PMID: 29020611 Authors demonstrated that the expression of S100A6 was significantly associated with patient age and tumor differentiation. PMID: 29053662 Data show that S100 calcium binding protein A6 (S100A6) is required for the Ca2+-dependent nuclear translocation of calcyclin binding protein (CacyBP/SIP) in colon cancer SW480 cells. PMID: 29534068 Isothermal titration calorimetry measured the binding of peptides with diverse sequence and biochemistry to human S100A5 and S110A6. These proteins bound distinct, but overlapping, sets of peptide targets. The specificity of S100 peptide interfaces is likely important for the biology of these proteins. PMID: 29240404 S100A6 is a potential risk marker for screening of cholangiocarcinoma. PMID: 29629840 The S100A6 interacts with FOR20 and related centrosomal proteins through a conserved N-terminal domain, suggesting a novel Ca(2+)-dependent regulation of centrosomal function. PMID: 28765046 REVIEW: summary of novel discoveries concerning S100A6 targets, its involvement in cellular signaling pathways, and presence in stem/progenitor cells, extracellular matrix and body fluids of diseased patients PMID: 28343163 Results showed that S100A6 was markedly up-regulated in nasopharyngeal carcinoma (NPC) tissues and cell lines and, may promote NPC development via the activation of p38/MAPK signaling pathways. PMID: 27596819 As an intracellular protein, S100A6 has been implicated in the regulation of several cellular functions, such as proliferation, apoptosis, the cytoskeleton dynamics, and the cellular response to different stress factors. S100A6 can be secreted/released by certain cell types which points to extracellular effects of the protein. [review] PMID: 28417162 suppression of S100A6 expression with RNAi significantly decreased the expression levels of beta-catenin, inhibited the growth and migration of eutopic endometrial stromal cells, and promoted their apoptosis. PMID: 28075439 Study reports the crystallographic structure of an S100-bound full-length RAGE ectodomain. The structure reveals a unique dimeric conformation of RAGE, which appears suited for signal transduction, and shows that the S100A6 protein adopts a non-canonical homodimeric arrangement. PMID: 27818100 STAT1 suppression by S100A6 may represent a promising therapeutic target to facilitate reendothelialization in damaged vessels. PMID: 27386938 findings strongly suggest that S100A6 may promote OS cell proliferation and OS tumor growth at least in part by facilitating cell cycle progression, preventing apoptosis, and inhibiting osteogenic differentiation PMID: 26646427 S100A6 induces EMT and promotes cell migration and invasion in a beta-catenin-dependent manner. PMID: 25799022 Weak or absent S100A6 staining supports a diagnosis of pilar leiomyoma, whereas strong positive staining supports a diagnosis of cutaneous leiomyosarcoma. PMID: 26238340 Elevated S100A6 enhances tumorigenesis and suppresses CXCL14-induced apoptosis in clear cell renal cell carcinoma. PMID: 25760073 Applying this serum marker to clinical practice would require less-invasive examinations of patients and would help to detect life-threatening cancerous lesions earlier than current modalities. PMID: 25743341 Results obtained proved that increased S100A6 content in keratinocytes dramatically changed the pace and extent of epidermal differentiation PMID: 25450463 High-level S100A6 promotes metastasis and predicts the outcome of T1-T2 stage in clear cell renal cell carcinoma PMID: 25120023 Data indicate that the interaction between S100A6 and integrin beta1, was confirmed by ELISA. PMID: 25256682 In Wharton's jelly of preeclamptic tissue S100 calcium binding protein A6(S100A6) is up-regulated and binds to different targets than in control suggesting involvement in development of preeclampsia PMID: 24746261 Following myocardial infarction, S100A6 expression levels increased in cardiomyocytes. PMID: 23844739 S100A6 may be involved in promotion and progression of human liver cancer. PMID: 24281831 Expression of S100A6 and MMP9 in combination is associated with the development of squamous cell carcinoma. PMID: 23993025 S100A6 and the TAZ2 domain of p300 bind p53 with similar affinities and S100A6 effectively competes with TAZ2 for binding to p53. PMID: 23796514 The S100A6 mutant protein interacts with the RAGE V domain in a symmetrical fashion forming a heterotetrameric complex. PMID: 23537648 native S1006 seeds SOD1 aggregation, shortening its nucleation process. This suggests a cross-talk between these two proteins involved in ALS. PMID: 23076148 Results show strong correlations between mRNA levels of PRA and PRB, protein levels of hormone receptors, HER/ErbB receptors and ligands network, and suggest that crosstalks between PR and the HER family are a hallmark of breast cancer growth. PMID: 22505232 Depletion of endothelial S100A6 levels also elevated beta-galactosidase expression, which is an important hallmark of cellular senescence and exit from the mammalian cell cycle PMID: 23095053 Upregulated expression of S100A6 is associated with gastric cancer. PMID: 22681645 Introduced a simple and efficient method for producing high-purity recombinant human S100A6 from Escherichia coli culture with low level of endotoxin. We further demonstrated its biological activities for triggering SH-SY5Y cells apoptosis in vitro. PMID: 22450162 S100A6 interacts with lamin A/C, a protein known to be implicated in colon carcinogenesis. PMID: 22560296 the overexpression of thioredoxin,S100-A10 and S100-A6 specifically distinguished metastatic from non-metastatic tumors PMID: 21938494 new insight into the interaction between S100 proteins and CacyBP/SIP PMID: 22295074 Calcyclin was identified to be underexpressed in small cell lung cancers, as compared with non-small cell lung cancers and normal lung tissue. PMID: 22192801 results show the presence of S100A6 in umbilical cord and suggest the involvement of this protein in intra- and extra-cellular signalling pathways in this tissue PMID: 21923636 S100A6 is necessary for nuclear translocation of the Sgt1 protein PMID: 20213445 Serum levels of S100B, S100A6 and S100P are associated with acute coronary syndrome, and serum levels and myocardial expression of these proteins are related to infarct size. PMID: 21663912 In melanocytic neoplasms composed of small spindle cells, patchy S100A6 staining should not be interpreted as evidence of supporting a diagnosis of melanoma PMID: 21039744 Results suggested that S100A6 plays an important role in the progression of gastric cancer, affecting patient prognosis, and is up-regulated by epigenetic regulation. PMID: 20581057 This study supports a role of S100A6 in thyroid tumorigenesis and as a potential aid in the discrimination between follicular thyroid tumors and papillary thyroid carcinoma. PMID: 20629554 S100A6 expression decreases along with cancerization in oral squamous cell carcinoma. PMID: 20596636 S100A6 expression level in cancer and metastatic lymph node was significantly higher than their matched non-neoplastic mucosa. S100A6 overexpression was associated with larger tumor size and deeper invasion. PMID: 19062716 S100A6 concentration predicts peritoneal tumor burden in mice with epithelial ovarian cancer and is associated with advanced stage in patients PMID: 19888321 Proteomic profiling in distinct cellular compartments led to the identification of a novel p53-dependent biomarker of telomere dysfunction, S100A6. PMID: 19834903 findings suggest that up-regulation of FRalpha gene and calcyclin gene expressions induced by Allitridi may play an important role in human gastric cancer cell differentiation PMID: 11925593 Results are consistent with S100A6, and most likely other S100 proteins, functioning as Ca(2+) sensors in a way analogous to the prototypical sensors calmodulin and troponin C. PMID: 11937060 Sgt1 binds to S100A6 in a calcium-regulated manner PMID: 12746458

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Protein S100-A6 (S100A6) Protein (His-SUMO)

Recombinant Human Protein S100-A6 (S100A6) Protein (His-SUMO)

Product Overview

Target Details

FAQs