Recombinant Human Protein S100-A3 (S100A3) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09279P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Protein S100-A3 (S100A3) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09279P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Protein S100-A3 (S100A3) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P33764 |
| Target Symbol | S100A3 |
| Synonyms | Protein S 100E; Protein S-100E; Protein S100 A3; Protein S100-A3; S100 calcium binding protein A3; S100 calcium-binding protein A3; S100a3; S100E; S10A3_HUMAN |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ |
| Expression Range | 1-101aa |
| Protein Length | Full Length |
| Mol. Weight | 38.6kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation. |
| Subcellular Location | Cytoplasm. |
| Protein Families | S-100 family |
| Database References | HGNC: 10493 OMIM: 176992 KEGG: hsa:6274 STRING: 9606.ENSP00000357701 UniGene: PMID: 28005267 |
