Recombinant Human Protein S100-A14 (S100A14) Protein (His-sumostar)
Beta LifeScience
SKU/CAT #: BLC-08054P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Protein S100-A14 (S100A14) Protein (His-sumostar)
Beta LifeScience
SKU/CAT #: BLC-08054P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Protein S100-A14 (S100A14) Protein (His-sumostar) is produced by our Yeast expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q9HCY8 |
| Target Symbol | S100A14 |
| Synonyms | BCMP84; Protein S100-A14; S100 calcium binding protein A14; S100 calcium-binding protein A14; S100a14; S100A15; S10AE_HUMAN; S114 |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-6His-sumostar |
| Target Protein Sequence | MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH |
| Expression Range | 1-104aa |
| Protein Length | Full Length |
| Mol. Weight | 27.7kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Modulates P53/TP53 protein levels, and thereby plays a role in the regulation of cell survival and apoptosis. Depending on the context, it can promote cell proliferation or apoptosis. Plays a role in the regulation of cell migration by modulating the levels of MMP2, a matrix protease that is under transcriptional control of P53/TP53. Does not bind calcium. |
| Subcellular Location | Cytoplasm. |
| Protein Families | S-100 family |
| Database References | HGNC: 18901 OMIM: 607986 KEGG: hsa:57402 STRING: 9606.ENSP00000340463 UniGene: PMID: 28950283 |
