Recombinant Human Protein S100-A14 (S100A14) Protein (His-sumostar)

Beta LifeScience SKU/CAT #: BLC-08054P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Protein S100-A14 (S100A14) Protein (His-sumostar)

Beta LifeScience SKU/CAT #: BLC-08054P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Protein S100-A14 (S100A14) Protein (His-sumostar) is produced by our Yeast expression system. This is a full length protein.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb Q9HCY8
Target Symbol S100A14
Synonyms BCMP84; Protein S100-A14; S100 calcium binding protein A14; S100 calcium-binding protein A14; S100a14; S100A15; S10AE_HUMAN; S114
Species Homo sapiens (Human)
Expression System Yeast
Tag N-6His-sumostar
Target Protein Sequence MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH
Expression Range 1-104aa
Protein Length Full Length
Mol. Weight 27.7kDa
Research Area Signal Transduction
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Modulates P53/TP53 protein levels, and thereby plays a role in the regulation of cell survival and apoptosis. Depending on the context, it can promote cell proliferation or apoptosis. Plays a role in the regulation of cell migration by modulating the levels of MMP2, a matrix protease that is under transcriptional control of P53/TP53. Does not bind calcium.
Subcellular Location Cytoplasm.
Protein Families S-100 family
Database References

HGNC: 18901

OMIM: 607986

KEGG: hsa:57402

STRING: 9606.ENSP00000340463

UniGene: PMID: 28950283

  • Increased S100A15 expression and decreased DNA methylation of its gene promoter region were associated with high metastasis potential and poor outcome in lung adenocarcinoma. PMID: 28498804
  • results indicate that S100A14 may have a role in the induction of differentiation and inhibition of cell metastasis in gastric cancer. PMID: 28726786
  • We identified a two-gene signature including KCNN4 and S100A14 which was related to recurrence in optimally debulked serous ovarian carcinoma patients PMID: 27270322
  • Co-expression of S100A14 and S100A16 correlates with a poor prognosis in human breast cancer and promotes cancer cell invasion PMID: 25884418
  • The antimicrobial peptides psoriasin (S100A7) and koebnerisin (S100A15) suppress extracellular matrix production and proliferation of human fibroblasts PMID: 25502330
  • S100A14 is expressed in epithelial-like, but not in mesenchymal-like, triple-negative breast cancer cells in vitro. PMID: 25912829
  • Data show that the genetic variant 425G>A on the 5'-UTR of calcium-binding protein S100A14 was associated with reduced S100A14 expression in gastric cancer (GC) cells. PMID: 25266115
  • Data indicate that S100A14 has a crucial role in EOC progression, and its overexpression is associated with poor prognosis. PMID: 24939856
  • Data demonstrate that S100A14 is transcriptionally regulated by JunB and involved in esophageal squamous cell carcinoma cell differentiation. PMID: 24107296
  • S100A14 interacts with S100A16 and regulates its expression in human cancer cells. PMID: 24086685
  • Data show that S100A14 and HER2 are colocalized in plasma membrane of breast cancer tissue cells and breast cancer cell lines. PMID: 24285542
  • High S100A14 expression is associated with metastasis of hepatocellular carcinoma. PMID: 23886191
  • The solution structure of homodimeric S100A14 in the apo state solved by NMR PMID: 23197251
  • that S100A14 promotes cell motility and invasiveness by regulating the expression and function of MMP2 in a p53-dependent manner. PMID: 22451655
  • S100A14 provides a novel role in oral squamous cell carcinoma cell proliferation by inducing G1-arrest PMID: 22032898
  • S100A14 induces cell apoptosis is partially in a RAGE-dependent manner PMID: 21559403
  • S100A14 and S100A4 have roles in metastasis in colorectal cancer after surgery PMID: 19956863
  • Data constitute strong evidence in support of the notion that S100A14 might function as a cancer suppressor working in the P53 pathway and play a role in esophageal carcinogenesis. PMID: 19351828
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed