Recombinant Human Protein S100-A14 (S100A14) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03182P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Protein S100-A14 (S100A14) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-03182P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Protein S100-A14 (S100A14) Protein (His) is produced by our Yeast expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q9HCY8 |
Target Symbol | S100A14 |
Synonyms | BCMP84; Protein S100-A14; S100 calcium binding protein A14; S100 calcium-binding protein A14; S100a14; S100A15; S10AE_HUMAN; S114 |
Species | Homo sapiens (Human) |
Expression System | Yeast |
Tag | N-6His |
Target Protein Sequence | MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH |
Expression Range | 1-104aa |
Protein Length | Full Length |
Mol. Weight | 13.7 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Modulates P53/TP53 protein levels, and thereby plays a role in the regulation of cell survival and apoptosis. Depending on the context, it can promote cell proliferation or apoptosis. Plays a role in the regulation of cell migration by modulating the levels of MMP2, a matrix protease that is under transcriptional control of P53/TP53. Does not bind calcium. |
Subcellular Location | Cytoplasm. |
Protein Families | S-100 family |
Database References | |
Tissue Specificity | Expressed at highest levels in colon and at moderate levels in thymus, kidney, liver, small intestine, and lung. Low expression in heart and no expression is seen in brain, skeletal muscle, spleen, placenta and peripheral blood leukocytes. |
Gene Functions References
- S100A14 is expressed in a subset of lung adenocarcinoma, and its expression is related to certain clinicopathological parameters. Furthermore, S100A14 expression was strongly correlated with migration and invasion in lung adenocarcinoma cells. PMID: 28950283
- Increased S100A15 expression and decreased DNA methylation of its gene promoter region were associated with high metastasis potential and poor outcome in lung adenocarcinoma. PMID: 28498804
- results indicate that S100A14 may have a role in the induction of differentiation and inhibition of cell metastasis in gastric cancer. PMID: 28726786
- We identified a two-gene signature including KCNN4 and S100A14 which was related to recurrence in optimally debulked serous ovarian carcinoma patients PMID: 27270322
- Co-expression of S100A14 and S100A16 correlates with a poor prognosis in human breast cancer and promotes cancer cell invasion PMID: 25884418
- The antimicrobial peptides psoriasin (S100A7) and koebnerisin (S100A15) suppress extracellular matrix production and proliferation of human fibroblasts PMID: 25502330
- S100A14 is expressed in epithelial-like, but not in mesenchymal-like, triple-negative breast cancer cells in vitro. PMID: 25912829
- Data show that the genetic variant 425G>A on the 5'-UTR of calcium-binding protein S100A14 was associated with reduced S100A14 expression in gastric cancer (GC) cells. PMID: 25266115
- Data indicate that S100A14 has a crucial role in EOC progression, and its overexpression is associated with poor prognosis. PMID: 24939856
- Data demonstrate that S100A14 is transcriptionally regulated by JunB and involved in esophageal squamous cell carcinoma cell differentiation. PMID: 24107296
- S100A14 interacts with S100A16 and regulates its expression in human cancer cells. PMID: 24086685
- Data show that S100A14 and HER2 are colocalized in plasma membrane of breast cancer tissue cells and breast cancer cell lines. PMID: 24285542
- High S100A14 expression is associated with metastasis of hepatocellular carcinoma. PMID: 23886191
- The solution structure of homodimeric S100A14 in the apo state solved by NMR PMID: 23197251
- that S100A14 promotes cell motility and invasiveness by regulating the expression and function of MMP2 in a p53-dependent manner. PMID: 22451655
- S100A14 provides a novel role in oral squamous cell carcinoma cell proliferation by inducing G1-arrest PMID: 22032898
- S100A14 induces cell apoptosis is partially in a RAGE-dependent manner PMID: 21559403
- S100A14 and S100A4 have roles in metastasis in colorectal cancer after surgery PMID: 19956863
- Data constitute strong evidence in support of the notion that S100A14 might function as a cancer suppressor working in the P53 pathway and play a role in esophageal carcinogenesis. PMID: 19351828