Recombinant Human Protein S100-A11 (S100A11) Protein (His-SUMO)

Name: Recombinant Human Protein S100-A11 (S100A11) Protein (His-SUMO)
Brand: Beta LifeScience
SKU: BLC-09961P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Protein S100-A11 (S100A11) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	P31949
Target Symbol	S100A11
Synonyms	Calgizzarin; Epididymis secretory protein Li 43; HEL S 43; Metastatic lymph node gene 70 protein; MLN 70; MLN70; Protein S100 A11; Protein S100-A11; Protein S100-A11, N-terminally processed; Protein S100-C; Protein S100A11; Protein S100C; S100 A11; S100 calcium binding protein A11; S100 calcium-binding protein A11 (calgizzarin); S100 calcium-binding protein A11; S100a11; S100C; S10AB_HUMAN
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His-SUMO
Target Protein Sequence	AKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
Expression Range	2-105aa
Protein Length	Full Length of Mature Protein
Mol. Weight	27.6kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Facilitates the differentiation and the cornification of keratinocytes.
Subcellular Location	Cytoplasm. Nucleus.
Protein Families	S-100 family
Database References	HGNC: 10488 OMIM: 603114 KEGG: hsa:6282 STRING: 9606.ENSP00000271638 UniGene: Hs.417004

Gene Functions References

Our present study indicated that S100A11 promotes EMT through accumulation of TGF-beta1 expression, and TGF-beta1-induced upregulation of p-SMAD2 and 3. PMID: 29569474
Results show that S100A11 expression is up-regulated by BC200 through stabilizing its mRNA and that S100A11 critically mediates the ability of BC200 RNA to induce cancer cell migration and invasion. PMID: 28277927
identified as a new regulator of Aldo-induced collagen production in human cardiac fibroblasts. PMID: 28739510
Furthermore, we identify flotillin-1 (FLOT1) and histone H1 as downstream factors for cytoplasmic and nuclear pathway of S100A11, which are required for LASP1-S100A11 axis-mediated epithelial-mesenchymal transition and colorectal cancer progression. PMID: 27181092
In patients with rheumatoid arthritis, S100A11 is up-regulated and is associated with inflammation and disease activity. PMID: 28446208
S100A11 overexpression correlates with an aggressive malignant phenotype and may constitute a novel prognostic factor for HGSC PMID: 26574635
we studied S100A11 and noted knockdown of S100A11 using short hairpin RNA, which inhibited proliferation, invasion, and migration of renal carcinoma cells as well as increased expression of E-cadherin and decreased expression of epidermal growth factor receptor/Akt in renal carcinoma cells. Therefore, S100A11 may be a key molecular target for treating renal carcinoma. PMID: 28513300
higher S100A11 expression was associated with statistically significant decrease in disease-free survival in clear cell renal cell carcinoma PMID: 26472670
the up-regulation of S100A11 plays a role in tumor progression, particularly in KRAS-mutated lung adenocarcinomas PMID: 26544866
metastatic cancer cells have elevated rate of cell injury and they rely on the S100A11-ANXA2 complex to enable cell membrane repair. S100A11 in a complex with Annexin A2 helps reseal the plasma membrane. PMID: 24806074
All three markers correlated significantly with regional lymph node metastasis: FXYD3 (p = 0.0110), S100A11 (p = 0.0071), and GSTM3 (p = 0.0173) in colon cancer lymphatic metastasis. PMID: 22430872
The EGFRvIII-STAT3 pathway promotes cell migration and invasion by upregulating S100A11 in hepatocellular carcinoma. PMID: 24376686
Proteomic data suggest a limited protein set is involved in SET- (template activating factor-I-) mediated cytotoxicity of TCE (trichloroethylene) in hepatocytes; this set includes CFL1 (cofilin 1), PRDX2 (peroxiredoxin 2), and S100-A11 (calgizzarin). PMID: 24631019
Our data indicate that S100A11 overexpression exerts a protumoral functional role in papillary thyroid carcinoma pathogenesis. PMID: 23928665
Data suggest that S100A11 is involved in maintenance of p21-CIP1 (cyclin-dependent kinase inhibitor 1A) protein stability (up-regulation; down-regulation) and appears to function as inhibitor of apoptosis in keratinocytes. PMID: 23745637
the structure of human calcium-bound S100A11. PMID: 22903637
Endometrial S100A11 is a crucial intermediator in EGF-stimulated embryo adhesion, endometrium receptivity, and immunotolerance via affecting Ca2+ uptake and release from intracellular Ca2+ stores. PMID: 22869607
Using transcriptional signatures of blood samples,identified S100A11 as a potential diagnostic marker of infective endocarditis, and AQP9 as a potential prognostic factor. PMID: 22319637
The expression level of S100C in lung cancer tissue was lower than that in ambient tissue. PMID: 18589612
investigated S100A11 expression in various subtypes of lung cancer and explored its role in cell proliferation. PMID: 21861103
S100A11 mediates HIMF-induced smooth muscle cell migration, vesicular exocytosis, and nuclear activation. PMID: 21139050
Data support that S100A11 is a novel diagnostic marker in breast carcinoma. PMID: 20372844
S100C is a new tumor marker protein, the expression of which significantly decreases after malignant transformation of human tissues. PMID: 11873942
S100Cis a key mediator of the Ca(2+)-induced growth inhibition of human keratinocytes in culture, and may be mediate growth regulation in vivo as well. PMID: 14623863
that redistribution along microtubules is a mechanism whereby S100A11 is positioned at the cell periphery in preparation for transglutaminase-dependent crosslinking. PMID: 14962086
Up-regulation of S100A11 was associated with the development of lymph node metastases in gastric cancer PMID: 15138568
Of several tested, only an N-terminal peptide with 19 amino acid residues induces apoptosis in human keratinocyte and squamous-cell carcinoma cell lines PMID: 15241500
findings suggest that S100A11 has an anti-apoptotic function and is related to the process of growth of human uterine leiomyoma PMID: 15322223
Down-regulation of S100C is associated with bladder cancer progression PMID: 15701847
Expression of S100A11, a putative tumor suppressor gene, is increased in the early stage of pancreatic carcinogenesis and decreased during subsequent progression to cancer. PMID: 17000675
S100C/A11-mediated pathway is at least partly involved in conferring upon human squamous cell cancers resistant to TGFbeta-induced growth suppression PMID: 17476473
The results indicated that the upregulation of S100A11 expression in non-small cell lung cancer tissues was significantly associated with higher tumor-node-metastasis stage (P = 0.001) and positive lymph node status PMID: 17537172
Proteomic mapping using a selective subcellular extraction kit revealed S100A11 as a new member of the S100 protein family modulated by glucocorticoids in keratinocytes. PMID: 17624315
Ca(2+)-dependent binding of S100A11 to ANXA1 facilitated the binding of the latter to cPLA(2), resulting in inhibition of cPLA(2) activity PMID: 17932043
These findings indicate that S100A11 plays a dual role in growth regulation of epithelial cells. PMID: 17978094
These findings suggest S100A11 could be helpful in the pathological study of colorectal cancer, especially for the classification of different stages in colorectal cancer. PMID: 18340452
S100/A11 and p21 gene expression was also found to be significantly lower in acute and chronic atopic dermatitis skin. PMID: 18385759
S100A11 targets Rad54B to sites of DNA DSB repair sites and has a role in p21-based regulation of cell cycle PMID: 18463164
Following transformation by transglutaminase 2, S100A11 acquires the capacity to signal through the p38 MAP kinase pathway, accelerate chondrocyte hypertrophy, and couple inflammation with chondrocyte activation to promote progression of osteoarthritis. PMID: 18523305
Phosphorylation of S100A11 induces a structural perturbation in the N-terminal edge of helix 1 and enables the phosphoryl group to be exposed to the solvent, allowing it to be recognized by the binding partner, nucleolin. PMID: 18618420
S100A11 differentially expressed in primary hepatocellular carcinoma , primary colorectal, and liver PMID: 19048101
Inhibition of S100A11 gene expression impairs the ability of keratinocytes to control vaccinia virus replication via downregulation of IFN-lambda receptor IL-10R2. PMID: 19577285
Down-regulation of S100C expression is associated with increasing tumor aggressiveness and poor prognosis in bladder cancer patients. PMID: 15701847

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.