Recombinant Human Protein S100-A10 (S100A10) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-09203P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Protein S100-A10 (S100A10) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-09203P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Protein S100-A10 (S100A10) Protein (His&Myc) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb P60903
Target Symbol S100A10
Synonyms 42C; AA409961; AL024248; Annexin II ligand; Annexin II ligand; calpactin I; light polypeptide ; Annexin II tetramer (AIIt) p11 subunit; Annexin II; light chain; ANX2L ; ANX2LG ; Ca[1] ; CAL12; CAL1L ; Calpactin I light chain; Calpactin I; p11 subunit; Calpactin-1 light chain; Cellular ligand of annexin II; CLP11 ; GP11 ; MGC111133 ; Nerve growth factor-induced protein 42C; OTTHUMP00000015269 ; OTTHUMP00000015270 ; p10 ; p10 protein; p11; Protein S100 A10; Protein S100-A10; S100 calcium binding protein A10 (annexin II ligand; calpactin I; light polypeptide (p11)) ; S100 calcium binding protein A10 (calpactin); S100 calcium binding protein A10; S100 calcium-binding protein A10; S100a10; S10AA_HUMAN
Species Homo sapiens (Human)
Expression System E.coli
Tag N-10His&C-Myc
Target Protein Sequence MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
Expression Range 1-97aa
Protein Length Full Length
Mol. Weight 18.2 kDa
Research Area Signal Transduction
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.
Protein Families S-100 family
Database References

HGNC: 10487

OMIM: 114085

KEGG: hsa:6281

STRING: 9606.ENSP00000357799

UniGene: PMID: 30143909

  • The overexpression of ANXA2 in U937 cells transfected with full-length ANXA2 cDNA was associated with increased S100A10 subunit, although S100A10 transcripts remained constitutive. PML/RARalpha fusion protein transactivated the ANXA2 promoter to upregulate ANXA2 and accumulate S100A10. PMID: 28687976
  • these studies define a new paradigm for plasminogen activation by the plasminogen receptor, S100A10 PMID: 28382372
  • These findings provides evidence that gene-gene interactions between p11, tPA and BDNF are all associated with post stroke depression. PMID: 29028593
  • Given that inflammation plays a role in both Parkinson's disease (PD)and depression, it is intriguing that peripheral p11 levels are altered in immune cells in both conditions. Our data provide insight into the pathological alterations occurring centrally and peripherally in PD. Moreover, if replicated in other cohorts, p11 could be an easily accessible biomarker PMID: 28137881
  • The S100A10 and S100B genes, which are located on different chromosomes, encode specialized calcium-binding proteins. These data support a role for calcium homeostasis in individuals with Cannabis Dependence and high risk sex behaviours. PMID: 28418321
  • These findings identify S100A10 as a player in endometrial receptivity acquisition. PMID: 26760977
  • Findings indicate that Munc13-4 supports acute WPB exocytosis by tethering WPBs to the plasma membrane via AnxA2-S100A10. PMID: 28450451
  • Here, the authors demonstrate that S100A10 is required for ULK1 localization to autophagosome formation sites. Silencing of S100A10 reduces IFN-gamma-induced autophagosome formation. PMID: 27871932
  • p11 might be a potential regulator on 5-HTR1b and 5-HTR4 as well as a predictor of or a therapeutic target for IFN-alpha-induced depression. PMID: 26821757
  • annexin A2 and S100A10 expressions are powerful predictors of serous ovarian cancer outcome. PMID: 26925708
  • These data show that disruption of ANX2/p11 interaction results in reduced ALL cell adhesion to osteoblasts, increased ALL cell sensitization to chemotherapy, and suppression of ALL cell homing and engraftment. PMID: 26465153
  • Annexin A2 complexes with S100 proteins: structure, function and pharmacological manipulation PMID: 25303710
  • Overexpression of miR-590-5P reduced the activity of luciferase expressed by a vector bearing the 3' untranslated region of S100A10 mRNA. Ectopic miR-590-5P overexpression mediated by lentiviral infection decreased expression of S100A10. PMID: 23598417
  • TPH1 gene polymorphisms and S100A10 expression, which correlate with 5-HT signaling were associated with ramosetron effectiveness in IBS-D, and may possibly lead to prospective identification of the resistance to treatment. PMID: 25428414
  • Authors show here that AnxA2, p11 and AHNAK are required for type 3 secretion system-mediated Salmonella invasion of cultured epithelial cells. PMID: 23931152
  • Data suggest a role for S100A10 as a prognostic marker and potential therapeutic target in colorectal cancer. PMID: 23828264
  • an annexin A2-S100A10 molecular bridge participates in cell-cell interactions, revealing a hitherto unexplored function of this protein interaction PMID: 23994525
  • complex formation of AnxA2 with S100A10 is a central regulatory mechanism in the acute release of VWF in response to cAMP-elevating agonists PMID: 23757730
  • Suggest annexin A10 as potential marker of sessile serrated adenoma/polyps. PMID: 23595865
  • extracellular C-1-P, acting through the extracellular annexin a2-p11 heterotetrameric protein, can mediate vascular endothelial cell invasion. PMID: 23696646
  • Annexin A2 and S100A10 regulate human papillomavirus type 16 entry and intracellular trafficking in human keratinocytes. PMID: 23637395
  • results demonstrate the crucial role of S100A10 in actin dynamics promoting cell spreading via Rac1 activation PMID: 23129259
  • Binding of AHNAK to the surface of AnxA2 is governed by several hydrophobic interactions between side chains of AHNAK and pockets on S100A10. PMID: 23275167
  • N-terminal acetylation of AnxA2 is required for S100A10 binding PMID: 23091277
  • The AHNAK peptide adopts a coil conformation that arches across the heterotetramer contacting both annexin A2 and S100A10 protomers with tight affinity. PMID: 22940583
  • Human chondrocytes with downregulated S100A10 showed significantly decreased production of inflammatory cytokines such as tumor necrosis factor-alpha, IL-1beta and IL-10; hence, S100A10 might be considered a potential target for anti-inflammatory treatment PMID: 22797859
  • Annexin A2 anchors S100A10 to the cell surface and, in doing so, allows S100A10 to play a prominent role in the activation of plasminogen in angiogenesis and oncogenesis. PMID: 22830395
  • annexin A2 heterotetramer contributes to HPV16 internalization and infection of epithelial cells and this interaction is dependent on the presence of the L2 minor capsid protein PMID: 22927980
  • COX7A2, TAGLN2 and S100-A10 as novel prognostic markers in Barrett's adenocarcinoma. PMID: 22365974
  • the overexpression of thioredoxin,S100-A10 and S100-A6 specifically distinguished metastatic from non-metastatic tumors. PMID: 21938494
  • Interferon-gamma stimulates p11-dependent surface expression of annexin A2 in lung epithelial cells to enhance phagocytosis. PMID: 21928315
  • This study demonstrates that PBMC p11 mRNA expression is associated with neural activation in the brain of BD patients and warrants a larger translational study to determine its clinical utility. PMID: 21722919
  • Both the annexin A2 and p11 subunits of calpactin I coimmunoprecipitate with human papillomavirus type 16 E5 in COS cells and in human epithelial cell lines, and an intact E5 C terminus is required for binding. PMID: 21849434
  • Understanding the chromatin remodeling involved in the glucocorticoid-mediated increase of p11 expression by stress may clarify stress-induced over-expression of p PMID: 21367534
  • The results of this study suggested that PBMC p11 mRNA levels may be a potential adjunctive biomarker for the assessment of suicide risk in mental disorders and warrants a larger translational study to determine its clinical utility. PMID: 20863517
  • DLC1 binding to S100A10 did not affect DLC1's RhoGAP activity, but it decreased the steady-state level of S100A10 expression. PMID: 21372205
  • S100A10 plays a crucial role in the generation of plasmin leading to fibrinolysis, thus providing a link to the clinical hemorrhagic phenotype of acute promyelocytic leukemia PMID: 21310922
  • The present study represents a first attempt to systematically understand the molecular basis for the calcium-insensitive open conformation of S100A10. PMID: 21269277
  • CFTR function by annexin A2-S100A10 complex has roles in health and disease [review] PMID: 20093721
  • First insights of S100A10 function as a regulator of the filamentous actin network. PMID: 20100475
  • These results suggest that epidermal growth factor treatment increased p11 bound to cPLA(2) may lead to the late suppression of AA release induced by EGF. PMID: 12163506
  • p11 interacts specifically with the TASK-1 K+ channel. PMID: 12198146
  • Calpactin light chain binds to bluetongue virus NS3 protein PMID: 12235365
  • IFN-gamma-stimulated p11 expression may serve a counterregulatory role in human epithelial cells PMID: 12645529
  • analysis of S100A10 interaction with tissue plasminogen activator, plasminogen, and plasmin PMID: 12730231
  • annexin 2/S100A10 complex functions in the intracellular positioning of recycling endosomes and that both subunits are required for this activity PMID: 13679511
  • Temperature stress-induced annexin 2 translocation is dependent on both expression of protein p11 tyrosine phosphorylation of annexin 2 PMID: 15302870
  • S100A10 and annexin A2 play an important role in plasmin regulation and in cancer cell invasiveness and metastasis [review] PMID: 15574370
  • complex with annexin II is a substrate of thioredoxin PMID: 15849182
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed