Recombinant Human Protein Quaking (QKI) Protein (GST)

Name: Recombinant Human Protein Quaking (QKI) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-08763P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Protein Quaking (QKI) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q96PU8
Target Symbol	QKI
Synonyms	DKFZp586I0923; HKQ; Homolog of mouse quaking QKI KH domain RNA binding protein; Hqk; HQK1; HqkI; OTTHUMP00000017581; OTTHUMP00000017582; OTTHUMP00000017583; Protein quaking; QK; QK1; QK3; QKI; QKI_HUMAN; QKI1; Quaking homolog; Quaking homolog KH domain RNA binding; Quaking homolog KH domain RNA binding mouse; Quaking isoform 1; Quaking protein; RNA binding protein HQK
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN
Expression Range	1-341aa
Protein Length	Full Length
Mol. Weight	64.7kDa
Research Area	Neuroscience
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	RNA-binding protein that plays a central role in myelinization. Binds to the 5'-NACUAAY-N(1,20)-UAAY-3' RNA core sequence. Regulates target mRNA stability. In addition, acts by regulating pre-mRNA splicing, mRNA export and protein translation. Required to protect and promote stability of mRNAs such as MBP and CDKN1B. Regulator of oligodendrocyte differentiation and maturation in the brain that may play a role in myelin and oligodendrocyte dysfunction in schizophrenia. Participates in mRNA transport by regulating the nuclear export of MBP mRNA. Also involved in regulation of mRNA splicing of MAG pre-mRNA. Acts as a translational repressor.
Subcellular Location	Nucleus. Cytoplasm.
Database References	HGNC: 21100 OMIM: 609590 KEGG: hsa:9444 STRING: 9606.ENSP00000355094 UniGene: PMID: 28552414 The results of this study have found an upregulation of QKI and its isoforms (QKI5, QKI6 and QKI7) in Sporadic Alzheimer's Disease patients compared to controls PMID: 27163826 QKI5 could inhibit gastric cancer cell proliferation, migration, and invasion in vitro and in vivo, which might be due to the altered splicing pattern of macroH2A1 pre-mRNA, leading to the accumulation of macroH2A1.1 isoform. PMID: 27092877 several splicing variants with functional relevance in lung cancer largely regulated by the splicing factor QKI, were identified. PMID: 27555542 QKI underexpression is associated with glioma. PMID: 27841882 Our results demonstrate that miR-143-3p acts as a tumor-suppressor by targeting QKI-5 in ESCC, suggesting that miR-143-3p is a potential therapy for the treatment of ESCC. PMID: 27358073 Methylation of the QKI promoter and concomitant reduced expression of QKI mRNA may be important for CRC initiation and progression. PMID: 28179294 quaking is essential in maintaining endothelial barrier function. PMID: 26905650 QKI-7 recruits PAPD4 to regulate post-transcriptional polyadenylation of target mRNAs. PMID: 26926106 QKI has a role in posttranscriptionally guiding macrophage identity and function. PMID: 27029405 MYB-QKI rearrangements promote tumorigenesis through three mechanisms: MYB activation by truncation, enhancer translocation driving aberrant MYB-QKI expression and hemizygous loss of the tumor suppressor QKI PMID: 26829751 Data implicate QKI in the pathophysiology of inflammation and leukemoogenesis where miR-155 is involved. PMID: 26337206 miR-155 regulates the cell cycle and invasion ability of colon cancer cells via the modulation of QKI expression PMID: 25420938 miR-29a promotes scavenger receptor A expression by targeting QKI during monocyte-macrophage differentiation. PMID: 26056009 QKI is a novel Cancer stem cells (CSC) inhibitor and impaired multiple oral CSC properties via partial repression of SOX2. PMID: 24918581 Using circScreen, study identified the RNA binding protein Quaking (QKI) as a major regulator of circRNA biogenesis in epithelial-mesenchymal transition (EMT) and show that introduction of consensus binding sequences for QKI into the flanking introns is sufficient to cause circRNAs to be produced from exons that normally only undergo canonical linear splicing. PMID: 25768908 QKI as a key regulator of alternative splicing in lung cancer. PMID: 24722255 QKI-mediated repression of FOXO1 may be one of the factors contributing to the oncogenesis and progression of breast carcinoma. PMID: 24398626 the QKI-5 expression may be a novel, independent factor in the prognosis of prostate cancer patients. PMID: 24153116 Propose that QKI is a central regulator of VSMC phenotypic plasticity and that intervention in QKI activity can ameliorate pathogenic, fibroproliferative responses to vascular injury. PMID: 23963726 Data showed that like QKI5/6/7 proteins, QKI7b protein was also significantly downregulated in most human colorectal cancer tissues. PMID: 23440637 QKI is a hub regulator of glia function in humans. PMID: 23321059 This work provides the first evidence that QK is a global regulator of splicing during muscle development in vertebrates and shows how overlapping splicing regulatory networks contribute to gene expression programs during differentiation. PMID: 23525800 Findings suggest that miR-574-5p is a potent ribo-regulator for Qkis and that aberrant miR-574-5p upregulation can be oncogenic. PMID: 22490519 The RNA-binding protein QKI5 is a direct target of C/EBPalpha and delays macrophage differentiation. PMID: 22398723 establish that p53 directly regulates Quaking (QKI) gene expression, and QKI protein associates with and leads to the stabilization of miR-20a PMID: 22751500 Multivariate analysis showed QKI expression was an independent prognostic factor for patient survival. PMID: 22569043 The QKI RNA-binding proteins regulate oligodendrocyte differentiation by modulating the expression of AIP-1. PMID: 20631256 E2F1 directly transcribes QKI, which, in turn, negatively regulates the cell cycle by targeting multiple cell cycle regulators, forming an E2F1-QKI-pRb/E2F1 negative feedback loop. PMID: 21768773 QKI, regulates the alternative splicing of macroH2A1 pre-mRNA, resulting in increased levels of macroH2A1.1. PMID: 21844227 HSV-1 infection promotes quaking RNA binding protein production and induces nuclear-cytoplasmic shuttling of quaking I-5 isoform in human hepatoma cells PMID: 21467216 QKI-7 regulates expression of interferon-related genes in human astrocyte glioma cells. PMID: 20927331 QKI functions as a principal regulator in the differentiation of colon epithelium and a suppressor of carcinogenesis through coordinately targeting multiple genes associated with cell growth and differentiation PMID: 19686745 QKI as a possible target for functional studies related to the role of myelination in schizophrenia. PMID: 16342280 QKI levels may regulate oligodendrocyte differentiation and maturation in human brain PMID: 16641098 Since QKI plays a fundamental role in oligodendrocyte differentiation and in myelination, its underexpression may be pivotal to, and upstream of, other myelin-associated gene expression abnormalities in schizophrenia. PMID: 17012699 QKI-6 is the major protein isoform responsible for central nervous system (CNS) myelination, which promotes myelin basic protein expression in oligodendrocytes. PMID: 17079655 biological functions attributed to this KH-type RNA binding protein and the recent achievements linking it to human disorders PMID: 17787018 we examined expression of QKI and several putative mRNA targets of QKI in human PFC and hippocampus at different ages PMID: 17918747 variants within the promoter region of QKI gene are unlikely to play a major role in susceptibility to schizophrenia in the Chinese population PMID: 18938205 The observation of consistent reductions in multiple isoforms of QKI mRNA in depressed suicide victims supports the growing body of evidence for a role of myelination-related deficits in the etiology of psychiatric disorders PMID: 19545858 There are many isoforms of this RNA binding protein. QKI-6 has been shown to be a translational repressor. PMID: 10535969

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.