Recombinant Human Protein Prune Homolog (PRUNE1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10059P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Protein Prune Homolog (PRUNE1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10059P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Protein Prune Homolog (PRUNE1) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q86TP1 |
| Target Symbol | PRUNE1 |
| Synonyms | DRES-17; DRES17; Drosophila-related expressed sequence 17; hPrune; HTcD37; Protein prune homolog; PRUNE; Prune homolog; PRUNE like protein; PRUNE_HUMAN; TcD37 homolog |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | MLRKDQKTIYRQGVKVAISAIYMDLEICEVLERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKKLLPLLQEALSAYFDSMKIPSGQPETADVSREQVDKELDRASNSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQISLSQSTTASLSKK |
| Expression Range | 1-168aa |
| Protein Length | Full Length of Isoform 6 |
| Mol. Weight | 22.5kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Phosphodiesterase (PDE) that has higher activity toward cAMP than cGMP, as substrate. Plays a role in cell proliferation, migration and differentiation, and acts as a negative regulator of NME1. Plays a role in the regulation of neurogenesis. Involved in the regulation of microtubule polymerization. |
| Subcellular Location | Cytoplasm. Nucleus. Cell junction, focal adhesion. Note=In some transfected cells a nuclear staining is also observed. |
| Protein Families | PPase class C family, Prune subfamily |
| Database References | HGNC: 13420 OMIM: 617413 KEGG: hsa:58497 STRING: 9606.ENSP00000271620 UniGene: PMID: 28334956 |
