Recombinant Human Protein Phosphatase 1B (PPM1B) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08614P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Protein Phosphatase 1B (PPM1B) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-08614P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Protein Phosphatase 1B (PPM1B) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O75688 |
| Target Symbol | PPM1B |
| Synonyms | MGC21657; OTTHUMP00000158953; OTTHUMP00000158954; OTTHUMP00000158955; OTTHUMP00000202394; OTTHUMP00000202395; OTTHUMP00000202399; PP2C beta; PP2C beta X; PP2C-beta; PP2CB; PP2Cbeta; PPC2BETAX; PPM 1B; Ppm1b; PPM1B_HUMAN; Protein phosphatase 1B (formerly 2C) magnesium dependent beta isoform; Protein phosphatase 1B; Protein phosphatase 1B magnesium dependent beta isoform; Protein phosphatase 2C beta isoform; Protein phosphatase 2C isoform beta; Protein phosphatase 2C like protein; Protein phosphatase, Mg2+/Mn2+ dependent, 1B |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | SIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI |
| Expression Range | 2-192aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 36.6kDa |
| Research Area | Signal Transduction |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Enzyme with a broad specificity. Dephosphorylates CDK2 and CDK6 in vitro. Dephosphorylates PRKAA1 and PRKAA2. Inhibits TBK1-mediated antiviral signaling by dephosphorylating it at 'Ser-172'. Plays an important role in the termination of TNF-alpha-mediated NF-kappa-B activation through dephosphorylating and inactivating IKBKB/IKKB. |
| Subcellular Location | Cytoplasm, cytosol. Membrane; Lipid-anchor. |
| Protein Families | PP2C family |
| Database References | HGNC: 9276 OMIM: 603770 KEGG: hsa:5495 STRING: 9606.ENSP00000282412 UniGene: PMID: 29307615 |
