Recombinant Human Protein Jagged-1 (JAG1) Protein (Fc-Myc)

Beta LifeScience SKU/CAT #: BLC-00002P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Protein Jagged-1 (JAG1) Protein (Fc-Myc)

Beta LifeScience SKU/CAT #: BLC-00002P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Protein Jagged-1 (JAG1) Protein (Fc-Myc) is produced by our Mammalian cell expression system. This is a protein fragment.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb P78504
Target Symbol JAG1
Synonyms AGS; AHD; AWS; CD 339; CD339; CD339 antigen; Headturner ; hJ1; Htu; Jag 1; Jag1; JAG1_HUMAN; Jagged 1; Jagged1 (Alagille syndrome) ; Jagged1; JAGL1; MGC104644; OTTHUMP00000030278; Protein jagged-1; Ser 1; Ser1; Serrate 1; Slalom
Species Homo sapiens (Human)
Expression System Mammalian cell
Tag C-FC-Myc
Target Protein Sequence VTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCE
Expression Range 185-334aa
Protein Length Partial
Mol. Weight 46.8 kDa
Research Area Cardiovascular
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Ligand for multiple Notch receptors and involved in the mediation of Notch signaling. May be involved in cell-fate decisions during hematopoiesis. Seems to be involved in early and late stages of mammalian cardiovascular development. Inhibits myoblast differentiation. Enhances fibroblast growth factor-induced angiogenesis (in vitro).
Subcellular Location Membrane; Single-pass type I membrane protein.
Database References

HGNC: 6188

OMIM: 118450

KEGG: hsa:182

STRING: 9606.ENSP00000254958

UniGene: PMID: 28566723

  • MFNG imposes a negative correlation between Jag1 and Notch, being high Jag1 in the absence of MFNG predictive of poor prognosis. PMID: 30065304
  • MiR-26b-5p acts as a tumor suppressor through suppressing cells proliferation and inducing cells apoptosis via directly targeting JAG1 in multiple myeloma PMID: 30098829
  • miR-30d may improve TGF-beta1-induced pulmonary fibrosis through direct binding to the 3'UTR of JAG1 and blocking JAG1/Notch signaling PMID: 30029934
  • these two lossoffunction JAG1 mutations may be associated with Alagille syndrome manifestations in these patients PMID: 29956768
  • Results provide evidence that JAG1 is downregulated by microRNA-128 binding its 3'UTR in glioma cells. PMID: 29091297
  • The demonstration that miR-124 inhibits gastric cancer cell growth supports the concept that miR-124 functions as a tumor suppressor by a mechanism that involves translational repression of the JAG1 and the inhibition of Notch signaling pathway. PMID: 28941308
  • The c.765C>T JAG1 variant is significantly associated with the pathogenesis of tetralogy of Fallot in the Iranian population. PMID: 29631691
  • Vascular smooth muscle cells were cyclically stretched on flexible membranes, as quantified via video tracking, demonstrating that the expression of Jagged1, Notch3, and target genes was down-regulated with strain. PMID: 29610298
  • This study identifies the unique role of JAG1-induced Notch activation in the pathogenesis of multiple myeloma PMID: 29242532
  • is an autosomal dominant disorder found to be linked to the Notch ligand JAG1.5 Approximately 90 percent of patients presenting with Alagille Syndrome have a mutation on the JAG1 gene that is located on chromosome 20p12. PMID: 29185945
  • These data indicate a process of NF-kappaB-induced miR-506 suppression and JAG1 upregulation upon IL-1beta induction. PMID: 28926924
  • In subjects with Alagille syndrome, incomplete clinical features of Alagille syndrome and biliary atresia, the frequency of mutations was as follows: single nucleotide variants (51.9%), small insertion or deletion (29.6%) and gross deletion (18.5%). PMID: 28695677
  • The Jagged1-Notch pathway showed elevated expression in AI-resistant breast cancer cells, resulting in macrophage differentiation towards M2 TAMs and there contributing to the acquisition of AI resistance. PMID: 28730338
  • Data show that Delta-like 4 (DLL4) and Jagged1 (JAG1) displayed equal potency in stimulating Notch target genes in HMEC-1 dermal microvascular endothelial cells but had opposing effects on sprouting angiogenesis in vitro. PMID: 28445154
  • Missense mutant of Jag1 (Jag1(Ndr)) disrupts bile duct development and is responsible for Alagille syndrome phenotypes in heart, eye, and craniofacial dysmorphology. PMID: 29162437
  • JAG1 was demonstrated to be a novel target of miR1405p, and miR1405p exerted its inhibitory effect on human glioma growth and invasion, partly by suppressing JAG1. PMID: 28713992
  • miR-141 may serve as an antioncomir in GSCs and markedly inhibit their self-renewal via downregulating Jagged1 expression levels in vitro and in vivo. PMID: 28535010
  • HIF1A potentiates Jagged 1-mediated angiogenesis by mesenchymal stem cell-derived exosomes. PMID: 28376567
  • the Notch signaling and atherosclerosis relevant markers in lesions from femoral arteries of symptomatic peripheral artery disease patients, were characterized. PMID: 28472949
  • Lower positive expression rate of RUNX3 and higher positive expression rate of Notch1 and Jagged 1 were observed in CRC tissues than those in normal adjacent tissues with a negative correlation, and the expression levels were associated with the differentiation degree, TNM staging, lymph node metastasis and tumor invasion depth (all P<0.05). PMID: 28498402
  • These findings imply that miR-199b-5p performs an inhibitory role in osteogenic differentiation in ligamentum flavum cells by potentially targeting JAG1 and influencing the Notch signalling pathway. PMID: 27957826
  • A three-molecule score based on the expression of Notch pathway molecules: Jagged1, intracellular Notch1 (ICN1) and Hes1 (JIH score) to assess prognostic value in non-metastasis clear cell renal cell carcinoma (ccRCC). PMID: 27612417
  • Jagged1 (JAG1) thymic medullary niche enriched for dendritic cells (DC)-lineage cells expressing Notch receptors indicate thymus as a DC-poietic organ, which provides selective microenvironments permissive for DC development. PMID: 28947612
  • Positive Jagged1 and DLL4 expression is closely correlated with severe clinicopathological characteristics and poor prognosis in patients with gallbladder cancers. PMID: 27174628
  • Data indicate that jagged 1 protein (JAG1)-mediated Notch signaling regulates differentiation of basal cells (BC) into secretory cells. PMID: 27216293
  • these results show that the Notch signaling pathway in T cells is crucial for the induction of TH2-mediated allergic airway inflammation in an house dust mite -driven asthma model but that expression of Jagged 1 or Jagged 2 on DCs is not required PMID: 28111308
  • Bruceine D inhibits hepatocellular carcinoma growth by targeting beta-catenin/jagged1 signaling pathways. PMID: 28645563
  • Results showed that JAG1 was significantly downregulated in miR-26a-overexpressing osteosarcoma cells and is a direct target of miR-26a. PMID: 27270422
  • the effects of two Notch ligands, i.e., Jagged1 and DLL1, on murine and human hematopoiesis in vitro. Our observations indicate that the stromal expression of Notch ligands increases the production of both the total and phenotypically early murine and human hematopoietic cells in the co-culture. PMID: 28537242
  • Specific Notch3 and Jag1 subcellular localization patterns may provide clues for the behavior of the corresponding tumors and could potentially be applied in the clinic for Jag1 targeting in triple-negative breast cancer patients. PMID: 28476798
  • there is a cross-talk between Jagged1/Notch3 and VEGF in TNBC angiogenesis. Jagged1/Notch3 is expected to be an important signaling pathway for TNBC progression and a potential target for TNBC neovascularization therapy. PMID: 28625320
  • Low levels of Notch pathway genes Notch1, Notch2, Notch4 and Jagged1 correlated with poor prognostic factors such as larger tumor size, positive lymph-node status, tumor phenotype and infiltrating tumor Treg cells. PMID: 27118257
  • Human Jagged-1 induced the proliferation and differentiation of CD133+ cord blood progenitors compared with hDll-1. Thus, hJagged-1 signaling in the bone marrow niche may be used to expand EPCs for therapeutic angiogenesis PMID: 27846321
  • By studying leprosy as a model, we provide evidence that upregulation of JAG1 on endothelium instructs monocytes to differentiate into M1 macrophages with antimicrobial activity. PMID: 27532668
  • High Jag1 expression is associated with metastasis in colorectal cancer. PMID: 28161537
  • amplification of Jagged1 contributed to mRNA expression that activates the Jagged1-Notch signaling pathway in liver cancer and led to poor outcome. PMID: 27315779
  • Our data revealed that MALAT1 inhibited tongue cancer cell growth and metastasis through miR-124-dependent JAG1 regulation. In conclusion, we revealed that MALAT1 may play an oncogenic role by increasing proliferation and metastasis of tongue cancer and is a potential therapeutic target in human tongue cancer. PMID: 28260102
  • Positive Jagged1 and DLL4 expression is closely correlated with severe clinicopathological characteristics and poor prognosis in patients with pancreatic ductal carcinoma. PMID: 27919854
  • miR-199a-3p targets YAP1, downregulates Jagged1 and suppresses the Notch signaling to inhibit hepatocellular carcinoma (HCC) cell proliferation and promote apoptosis. These findings provide new insights into the mechanism by which miR-199a-3p suppresses HCC cell proliferation and induces apoptosis. PMID: 27832779
  • Jagged1 activation of Notch3 resulted in a significant decrease in cell proliferation while concomitantly promoting Hemangioma-pericyte maturation. PMID: 27941324
  • expression of JAG1 is regulated by various pathways and is associated with poor prognosis through promoting the epithelial to mesenchymal transition and cell proliferation or maintaining cell survival in colorectal cancer PMID: 27589478
  • AGS is caused by mutations in one of two genes, namely, JAG1 or NOTCH2. These genes are part of the Notch signaling pathway, which is involved in cell fate determination. JAG1 mutations have been identified in 70-94% of individuals with clinically diagnosed AGS PMID: 25676721
  • On complete gene sequencing of JAG1 gene as described before, the patient was shown to be heterozygous for a known pathogenic mutationc.270delG (p.C92AfsX69) in exon 2 PMID: 25596152
  • JAG1 protein expression was significant positive correlation with lymph node metastasis, pathological grades invasive ductal carcinoma of breast.JAG1 gene methylation level in breast cancer. PMID: 26971121
  • these findings demonstrate that 50 microM EGCG protects against ox-LDL-induced endothelial dysfunction through the Jagged-1/Notch signaling pathway. PMID: 26648562
  • PKCalpha Attenuates Jagged-1-Mediated Notch Signaling in ErbB-2-Positive Breast Cancer to Reverse Trastuzumab Resistance PMID: 26350262
  • Immunohistochemical panel of CDX2, p120ctn, c-Myc, and Jagged1 proteins would be to distinguish between low/high grade dysplasia in histologically challenging cases of Barrett's esophagus. PMID: 26926447
  • High Jagged1 expression is associated with colorectal cancer. PMID: 26406415
  • High Jagged1 expression is associated with Prostatic Intraepithelial Neoplasia. PMID: 26341090
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed