Recombinant Human Protein Jagged-1 (JAG1) Protein (Fc-Myc)
Beta LifeScience
SKU/CAT #: BLC-00002P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Protein Jagged-1 (JAG1) Protein (Fc-Myc)
Beta LifeScience
SKU/CAT #: BLC-00002P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Protein Jagged-1 (JAG1) Protein (Fc-Myc) is produced by our Mammalian cell expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P78504 |
| Target Symbol | JAG1 |
| Synonyms | AGS; AHD; AWS; CD 339; CD339; CD339 antigen; Headturner ; hJ1; Htu; Jag 1; Jag1; JAG1_HUMAN; Jagged 1; Jagged1 (Alagille syndrome) ; Jagged1; JAGL1; MGC104644; OTTHUMP00000030278; Protein jagged-1; Ser 1; Ser1; Serrate 1; Slalom |
| Species | Homo sapiens (Human) |
| Expression System | Mammalian cell |
| Tag | C-FC-Myc |
| Target Protein Sequence | VTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSPKHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYCGTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCE |
| Expression Range | 185-334aa |
| Protein Length | Partial |
| Mol. Weight | 46.8 kDa |
| Research Area | Cardiovascular |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Ligand for multiple Notch receptors and involved in the mediation of Notch signaling. May be involved in cell-fate decisions during hematopoiesis. Seems to be involved in early and late stages of mammalian cardiovascular development. Inhibits myoblast differentiation. Enhances fibroblast growth factor-induced angiogenesis (in vitro). |
| Subcellular Location | Membrane; Single-pass type I membrane protein. |
| Database References | HGNC: 6188 OMIM: 118450 KEGG: hsa:182 STRING: 9606.ENSP00000254958 UniGene: PMID: 28566723 |
