Recombinant Human Protein Disulfide-Isomerase Tmx3 (TMX3) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09917P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Protein Disulfide-Isomerase Tmx3 (TMX3) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09917P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Protein Disulfide-Isomerase Tmx3 (TMX3) Protein (His-SUMO) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q96JJ7 |
| Target Symbol | TMX3 |
| Synonyms | KIAA1830; PDIA13; Protein disulfide isomerase family A, member 13; Protein disulfide-isomerase TMX3; Thioredoxin domain containing 10; Thioredoxin domain-containing protein 10; Thioredoxin-related transmembrane protein 3; TMX3; TMX3_HUMAN; TXNDC10 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | KGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFEHMQKRHRVFFVYVGGESPLKEKYIDAASELIVYTYFFSASEEVVPEVIFKI |
| Expression Range | 25-195aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 35.6kDa |
| Research Area | Metabolism |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Probable disulfide isomerase, which participates in the folding of proteins containing disulfide bonds. May act as a dithiol oxidase. |
| Subcellular Location | Endoplasmic reticulum membrane; Single-pass membrane protein. |
| Protein Families | Protein disulfide isomerase family |
| Database References | HGNC: 24718 OMIM: 616102 KEGG: hsa:54495 STRING: 9606.ENSP00000299608 UniGene: PMID: 20485507 |
