Recombinant Human Protein Atonal Homolog 1 (ATOH1) Protein (His)

Name: Recombinant Human Protein Atonal Homolog 1 (ATOH1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10362P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Protein Atonal Homolog 1 (ATOH1) Protein (His) is produced by our Yeast expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q92858
Target Symbol	ATOH1
Synonyms	ATH1; ATOH1; ATOH1_HUMAN; Atonal homolog 1 (Drosophila); Atonal homolog 1; bHLHa14; Class A basic helix-loop-helix protein 14; hATH1; Helix loop helix protein hATH 1; Helix-loop-helix protein hATH-1; MATH 1; MATH1; Protein atonal homolog 1
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS
Expression Range	1-354aa
Protein Length	Full Length
Mol. Weight	40.2kDa
Research Area	Epigenetics And Nuclear Signaling
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.
Subcellular Location	Nucleus.
Database References	HGNC: 797 OMIM: 601461 KEGG: hsa:474 STRING: 9606.ENSP00000302216 UniGene: PMID: 29436668 The authors discovered tyrosine 78 of Atoh1 is phosphorylated by a Jak2-mediated pathway only in tumor-initiating cells and in human Sonic Hedgehog-type medulloblastoma. PMID: 29168692 ATOH1 expression was detected consistently in recurrent and metastatic SHH medulloblastoma. Chromatin immunoprecipitation sequencing and gene expression profiling identified candidate ATOH1 targets in tumor cells involved in development and tumorigenesis. PMID: 28490517 These data indicate that the regulation of Atoh1 by the ubiquitin proteasome pathway is necessary for hair cell fate determination and survival. PMID: 27542412 ATOH1 is increased in advanced Merkel cell carcinoma (MCC) indicating that ATOH1 is involved in MCC progression. PMID: 27624714 Study provides evidence that Sox2 expression is required for the late stages of progenitor cell differentiation to hair cells and stimulates Atoh1 expression through a concentration dependent molecular interaction with the 3' enhancer of Atoh1. PMID: 26988140 mutation not found in group of children with sensorineural hearing loss PMID: 26634621 Downregulation of Hath1 expression promoted the proliferation and reduced the apoptosis of KUMA5 squamous cell carcinoma cells. PMID: 26648003 ATOH1 can induce the differentiation of gastric cancer stem cells. PMID: 25950549 ATOH1 acts in concert with other transcription factors to directly regulate the cochlear hair cell phenotype. PMID: 25015561 Testosterone-bovine serum albumin and Math1 treatment could promote an increase in hair-cell like cells in the lesser epithelial ridge through proliferation and transdifferentiation. PMID: 25957791 Atoh1 epigenetic regulation guides hair cell development in the mammalian cochlea PMID: 26487780 Atoh1 protein stabilization induced both a cancer stem cell phenotype and a mucinous phenotype, resulting in the acquisition of chemoresistance in colorectal cancer PMID: 26017781 Chicken Atoh1 might have intrinsic functional differences to mammalian Atoh1. PMID: 25412697 In this review, expression of the Atoh1 gene in supporting cells, results in their transformation into immature hair cells. PMID: 25648190 Data suggest that Atoh1 high expression correlates with a good prognosis and it may serve as a favorable prognostic factor for GIST. PMID: 25400808 Expression of Hath1, Muc2, cyclin D1 and p27 in the xenograft tumors was also detected. PMID: 23464457 Atoh1 transfection drives highly efficient differentiation of human pluripotent stem cells into dopaminergic neurons. PMID: 24904172 cotransfection of Pax2 and Math1 strongly stimulates in situ hair cell regeneration in neomycin-damaged cochlear explants. PMID: 24141260 The transcription factor Atoh1, which is both necessary and sufficient for hair cell development. PMID: 23724999 the Atoh1 protein regulates malignant potential rather than the differentiation phenotype of mucinous colon cancer (MC), suggesting the mechanism by which MC and signet ring cell carcinoma are more malignant than non-mucinous adenocarcinoma. PMID: 23333391 Nuclear expression of Atoh1 was inversely correlated with the differentiation and primary tumor stage of lung cancers and also the downregulation of the Wnt pathway. PMID: 23030416 H. pylori up-regulates Hath1 expression through inducing the release of IL-8 in MKN28 cells. PMID: 22786753 Transfection of hATOH1 in combination with hTCF3 or hGATA3 induced 2-3X more Pou4f3/GFP cells, and similarly enhanced Pou4f3/GFP and myosin VIIa double-positive cells, when compared to hATOH1 alone PMID: 22985730 involved in differentiation of neurons, secretory cells in the gut, and mechanoreceptors including auditory hair cells [review] PMID: 22370966 In vivo conversion of pillar cells and Deiters' cells into immature auditory hair cells by Atoh1 is age dependent and resembles normal auditory hair cell development. PMID: 22573682 Atoh1 activates cell proliferation within the normally postmitotic cochlear epithelium. PMID: 22573692 Math1/Atoh1 ectopic expression significantly reduced cell proliferation and altered cell morphology in Barrett esophagus PMID: 22147253 Longitudinal cell formation in the small intestine was regulated by the colocalization of Hath1 and Klf4 that converted Paneth cell differentiation into goblet cell differentiation. PMID: 21125297 Atonal homolog 1 is required for growth and differentiation effects of notch/gamma-secretase inhibitors on normal and cancerous intestinal epithelial cells. PMID: 20621629 we investigated by immunohistochemistry the expression of Hath1 in 63 neuroendocrine tumors PMID: 19924642 Maps to 10q21-22. Candidate gene for optic nerve aplasia and related syndromes. PMID: 11889557 Proneural and proneuroendocrine transcription factor expression in cutaneous mechanoreceptor (Merkel) cells and Merkel cell carcinoma PMID: 12209986 Hath1 may regulate the expression of MUC2, a mucin secreted by goblet cells, and Hath1 may also be a novel factor normally repressed as a consequence of activation of the Wnt signaling pathway [review] PMID: 16382053 Hath1 is one of the transcriptional regulators for MUC6 and MUC5AC in gastric cancer cells. PMID: 16647036 Based on these results, we hypothesize that Cdx2 is involved in activating Math1 expression in intestinal epithelial cells. PMID: 16831200 HATH1 is an important factor in the up-regulation of MUC2 expression that occurs in mucinous cancers and signet ring carcinomas. PMID: 17000673 GSK3beta-dependent protein degradation was switched between Hath1 and beta-catenin by Wnt signaling, leading to the dramatic alteration of cell status between proliferation and differentiation in colon cancer PMID: 17241872 In the chimeric environment, genotypically wild-type cells that possess Math1 have the competence to differentiate into hair cells by providing appropriate environmental interactions. PMID: 17397818 Patients with ATOH1-expressing adenocarcinomas might have a worse prognosis. PMID: 17549667 ATOH1 activates hairy and enhancer of split 6 transcription through binding to three clustered E boxes of its promoter PMID: 17826772 Hath1 protein degradation may be required for maintaining the undifferentiated state of colon cancers, and that GSK3 inhibitors have potential for use in cancer therapy. PMID: 18275842 Our data indicate that ATOH1 may be an early target for oncogenic mutations in tissues where it instructs cellular differentiation. PMID: 19243219 Adult Atoh1-conditional knock-out mice are behaviorally deaf, have diminished auditory brainstem responses and disrupted auditory nuclei morphology. PMID: 19741118

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

📧 inquiry@betalifesci.com 📞 +1(201) 888-7983

Contact Us Now for Inquiries, Orders, and Questions

Recombinant Human Protein Atonal Homolog 1 (ATOH1) Protein (His)

Recombinant Human Protein Atonal Homolog 1 (ATOH1) Protein (His)

Product Overview

Target Details

FAQs