Recombinant Human Proteasome Subunit Beta Type-8 (PSMB8) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-02850P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Proteasome Subunit Beta Type-8 (PSMB8) Protein (His-SUMO&Myc)
Beta LifeScience
SKU/CAT #: BLC-02850P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Proteasome Subunit Beta Type-8 (PSMB8) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | P28062 |
| Target Symbol | PSMB8 |
| Synonyms | ALDD; D6S216; D6S216E; Large multifunctional peptidase 7; Large multifunctional protease 7; LMP 7; LMP7; Low molecular mass protein 7; Low molecular weight protein 7; Macropain subunit C13; MGC1491; Multicatalytic endopeptidase complex subunit C13; NKJO; OTTHUMP00000062981; Protease component C13; Proteasome (prosome macropain) subunit beta type 8; Proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7); Proteasome beta 8 subunit; Proteasome catalytic subunit 3i; Proteasome component C13; Proteasome related gene 7; Proteasome subunit beta 5i; Proteasome subunit beta 8; Proteasome subunit beta type 8; Proteasome subunit beta type; Proteasome subunit beta type-8; Proteasome subunit beta-5i; Proteasome subunit Y2; PSB8_HUMAN; PSMB 8; PSMB5i; PSMB8; Really interesting new gene 10 protein; RING 10; RING10; Y2 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-10His-SUMO&C-Myc |
| Target Protein Sequence | TTTLAFKFQHGVIAAVDSRASAGSYISALRVNKVIEINPYLLGTMSGCAADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMCQYRGMGLSMGSMICGWDKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ |
| Expression Range | 73-276aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 42.7 kDa |
| Research Area | Cell Biology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB5 by PSMB8 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. Involved in the generation of spliced peptides resulting from the ligation of two separate proteasomal cleavage products that are not contiguous in the parental protein. Acts as a major component of interferon gamma-induced sensitivity. Plays a key role in apoptosis via the degradation of the apoptotic inhibitor MCL1. May be involved in the inflammatory response pathway. In cancer cells, substitution of isoform 1 (E2) by isoform 2 (E1) results in immunoproteasome deficiency. Required for the differentiation of preadipocytes into adipocytes. |
| Subcellular Location | Cytoplasm. Nucleus. |
| Protein Families | Peptidase T1B family |
| Database References | HGNC: 9545 OMIM: 177046 KEGG: hsa:5696 STRING: 9606.ENSP00000364016 UniGene: PMID: 29428669 |
