Recombinant Human Proteasome Subunit Beta Type-4 (PSMB4) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-08510P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.

Recombinant Human Proteasome Subunit Beta Type-4 (PSMB4) Protein (GST)

Beta LifeScience SKU/CAT #: BLC-08510P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Proteasome Subunit Beta Type-4 (PSMB4) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb P28070
Target Symbol PSMB4
Synonyms 26 kDa prosomal protein; HN3; HsBPROS26; HSN3; Macropain beta chain; Multicatalytic endopeptidase complex beta chain; PROS-26; PROS26; Proteasome (prosome macropain) subunit beta type 4 ; Proteasome beta 4 subunit; Proteasome beta chain; Proteasome chain 3; Proteasome subunit beta 4; Proteasome subunit beta type 4; Proteasome subunit beta type-4; Proteasome subunit HsN3; PSB4_HUMAN; PSMB 4; PSMB4
Species Homo sapiens (Human)
Expression System E.coli
Tag N-GST
Target Protein Sequence TQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE
Expression Range 46-264aa
Protein Length Full Length of Mature Protein
Mol. Weight 51.4kDa
Research Area Immunology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Non-catalytic component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1.
Subcellular Location Cytoplasm. Nucleus.
Protein Families Peptidase T1B family
Database References

HGNC: 9541

OMIM: 602177

KEGG: hsa:5692

STRING: 9606.ENSP00000290541

UniGene: PMID: 30066880

  • PSMB4 knockdown decreased the expression levels of MMP2, MMP9 and cathepsin B and decreased proliferation, migration and invasion abilities in human GBM cells. PMID: 29414809
  • We further identified miR-148b as a negative regulator of proteasome beta-4 subunit. Enforced expression of miR-148b resulted in vitro growth inhibition of melanoma cells, whereas this inhibition was further abolished by enforced expression of proteasome beta-4 subunit PMID: 28656878
  • Our findings implied that PSMB4 is involved in the progression of EOC (epithelial ovarian cancer) and could serve as potential therapeutical target of EOC. These data suggested that PSMB4 may promote cell proliferation via the NF-kappaB-target gene in EOC (epithelial ovarian cancer) PMID: 26439929
  • Taken together, our results demonstrated that PSMB4 regulated MM cell growth in part by activating NF-kappaB-miR-21 signaling, which may represent promising targets for novel specific therapies. PMID: 25656574
  • Data indicate that recruitment of proteasomes into mutant huntingtin (mHTT) protein initiated inclusion bodies (IBs) was observed when the PSMB4-GFP was co-expressed with mHTT. PMID: 24291262
  • proteasome subunit beta type 4 (PSMB4), the beta7 subunit of the 20S core complex, was identified as a direct binding partner of CRBN. PMID: 23026050
  • While 26 proteasome dysfunction is observed in Parkinson's disease (PD), diverse mutations in the parkin gene are linked to early-onset autosomal-recessive forms of familial PD. PMID: 20810900
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed