Recombinant Human Proteasome Subunit Beta Type-10 (PSMB10) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09245P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Proteasome Subunit Beta Type-10 (PSMB10) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09245P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Proteasome Subunit Beta Type-10 (PSMB10) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P40306 |
Target Symbol | PSMB10 |
Synonyms | beta2i; FLJ00366; LMP10; Low molecular mass protein 10; Macropain subunit MECl 1; Macropain subunit MECl-1; MECL1; MGC1665; Multicatalytic endopeptidase complex subunit MECl 1; Multicatalytic endopeptidase complex subunit MECl-1; OTTHUMP00000174858; Proteasome (prosome macropain) subunit beta type 10; Proteasome beta 10 subunit; Proteasome catalytic subunit 2i; Proteasome MECl 1; Proteasome MECl-1; Proteasome subunit beta 2i; Proteasome subunit beta 7i; Proteasome subunit beta type 10; Proteasome subunit beta type-10; Proteasome subunit beta-2i; Proteasome subunit MECL1; PSB10_HUMAN; PSMB 10; Psmb10 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE |
Expression Range | 1-273aa |
Protein Length | Full Length |
Mol. Weight | 51.6kDa |
Research Area | Immunology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. |
Subcellular Location | Cytoplasm. Nucleus. |
Protein Families | Peptidase T1B family |
Database References | HGNC: 9538 OMIM: 176847 KEGG: hsa:5699 STRING: 9606.ENSP00000351314 UniGene: PMID: 29499566 |