Recombinant Human Proteasome Subunit Beta Type-1 (PSMB1) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08508P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Proteasome Subunit Beta Type-1 (PSMB1) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08508P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Proteasome Subunit Beta Type-1 (PSMB1) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P20618 |
| Target Symbol | PSMB1 |
| Synonyms | FLJ25321; HC5; KIAA1838; Macropain subunit C5; Multicatalytic endopeptidase complex subunit C5; Proteasome (prosome macropain) subunit beta type 1; Proteasome beta 1 subunit; Proteasome component C5; Proteasome gamma chain; Proteasome subunit beta type 1; Proteasome subunit beta type-1; Proteasome subunit HC5; PSB1_HUMAN; PSC5; PSMB 1; PSMB1 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | RFSPYVFNGGTILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD |
| Expression Range | 29-241aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 50.5kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Non-catalytic component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). |
| Subcellular Location | Cytoplasm. Nucleus. |
| Protein Families | Peptidase T1B family |
| Database References | HGNC: 9537 OMIM: 602017 KEGG: hsa:5689 STRING: 9606.ENSP00000262193 UniGene: PMID: 28733196 |
