Recombinant Human Proteasome Activator Complex Subunit 3 (PSME3) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08298P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Proteasome Activator Complex Subunit 3 (PSME3) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08298P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Proteasome Activator Complex Subunit 3 (PSME3) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P61289 |
| Target Symbol | PSME3 |
| Synonyms | 11S regulator complex gamma subunit; 11S regulator complex subunit gamma; Activator of multicatalytic protease subunit 3; Ki; Ki antigen; Ki nuclear autoantigen; Ki, PA28 gamma; PA28 gamma; PA28g; PA28gamma; Proteasome (prosome, macropain) activator subunit 3 (PA28 gamma, Ki); Proteasome (prosome, macropain) activator subunit 3; Proteasome activator 28 gamma; Proteasome activator 28 subunit gamma; Proteasome activator complex subunit 3; Proteasome activator subunit 3; PSME3; PSME3_HUMAN; REG GAMMA; REG-gamma |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | ASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAET |
| Expression Range | 2-252aa |
| Protein Length | Partial |
| Mol. Weight | 56.1kDa |
| Research Area | Apoptosis |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Subunit of the 11S REG-gamma (also called PA28-gamma) proteasome regulator, a doughnut-shaped homoheptamer which associates with the proteasome. 11S REG-gamma activates the trypsin-like catalytic subunit of the proteasome but inhibits the chymotrypsin-like and postglutamyl-preferring (PGPH) subunits. Facilitates the MDM2-p53/TP53 interaction which promotes ubiquitination- and MDM2-dependent proteasomal degradation of p53/TP53, limiting its accumulation and resulting in inhibited apoptosis after DNA damage. May also be involved in cell cycle regulation. Mediates CCAR2 and CHEK2-dependent SIRT1 inhibition. |
| Subcellular Location | Nucleus. Cytoplasm. |
| Protein Families | PA28 family |
| Database References | HGNC: 9570 OMIM: 605129 KEGG: hsa:10197 STRING: 9606.ENSP00000293362 UniGene: PMID: 29020881 |
