Recombinant Human Prostaglandin E Synthase 3 (PTGES3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-02553P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Prostaglandin E Synthase 3 (PTGES3) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-02553P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Prostaglandin E Synthase 3 (PTGES3) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q15185 |
Target Symbol | PTGES3 |
Synonyms | Co chaperone p23; cPGES; Cytosolic prostaglandin E synthase; Cytosolic prostaglandin E2 synthase; Hsp90 co chaperone; Hsp90 co-chaperone; P23; Progesterone receptor complex; Progesterone receptor complex p23; Prostaglandin E synthase 3 (cytosolic); Prostaglandin E synthase 3; PTGES 3; PTGES3; Sid 3177; TEBP; TEBP_HUMAN; Telomerase binding protein p23; Telomerase-binding protein p23; Unactive progesterone receptor 23 kD |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-10His |
Target Protein Sequence | MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE |
Expression Range | 1-160aa |
Protein Length | Full Length |
Mol. Weight | 24.2 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Cytosolic prostaglandin synthase that catalyzes the oxidoreduction of prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). Molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. Facilitates HIF alpha proteins hydroxylation via interaction with EGLN1/PHD2, leading to recruit EGLN1/PHD2 to the HSP90 pathway. |
Subcellular Location | Cytoplasm. |
Protein Families | P23/wos2 family |
Database References |
Gene Functions References
- The Hsp90 independence of the interaction between p23 and p53 DNA-binding domain, together with the competition of p23 versus DNA for p53, raises the intriguing possibility that p23, like other small charged proteins, may affect p53 in hitherto unknown ways. PMID: 29334217
- dysregulation of GR, MR, FKBP5, and PTGES3 in autistic spectrum disorder (ASD) and suggest a possible role of inflammation in altered GR function in ASD. PMID: 25912394
- increased p23 expression may allow cells to acquire a more aggressive phenotype, contributing to disease progression PMID: 25241147
- Even if p23 predominantly binds the Hsp90 dimer, p23 is also able to interact with Hsp90 oligomers, shifting the Hsp90 dimer-oligomers equilibrium toward dimer. PMID: 26151834
- FKBP4, p23, and Aha1 cooperatively regulate the progression of hAgo2 through the chaperone cycle. PMID: 23741051
- p23 recruits PHD2 to the HSP90 machinery to facilitate HIF-1alpha hydroxylation PMID: 23413029
- The effects of p23 on androgen receptor (AR) activity are at least partly HSP90 independent, a mutant form of p23, unable to bind HSP90, increases AR activity. PMID: 22899854
- p23 co-chaperone protects the aryl hydrocarbon receptor from degradation PMID: 22759865
- As an anti-apoptotic factor, p23 is able to be a potential target for anti-leukemic therapy. PMID: 22677230
- Patients with severe Alzheimer disease displayed a consistent reduction in brain p23 levels. Cleavage product p19 was not seen in AD brain samples. PMID: 21691801
- a small increase in the expression of p23 amplifies ER-binding genome wide and, in combination with ER, elicits an invasive phenotype in breast cancer PMID: 22074947
- In cytosol only one protein called p23 hsp90 binds to Bax but the binding protein does not affect the subcellular localization and pro-apoptotic activity of Bax. PMID: 22277657
- Data show that cytosolic prostaglandin E synthase 2 is found in microglia, neurons, and endothelium of control human middle frontal gyrus and that its levels decrease in pyramidal cells of Alzheimer's disease brains. PMID: 19001348
- The p23 cochaperone of Hsp90, which plays a major role in glucocorticoid receptor folding and function, associates with influenza virus polymerase. PMID: 21853119
- the N-terminal domain of human Hsp90 triggers binding to the cochaperone p23 PMID: 21183720
- High levels of Hsp90 cochaperone p23 promote tumor progression in breast cancer by increasing lymph node metastases and drug resistance. PMID: 20847343
- the interaction of the Hsp90-p23 complex with hTERT is critical for regulation of the nuclear localization of telomerase PMID: 19751963
- Data show that the small molecule celastrol inhibits the Hsp90 chaperoning machinery by inactivating the co-chaperone p23, resulting in a more selective destabilization of steroid receptors. PMID: 19996313
- localizes in vivo to genomic response elements in a hormone-dependent manner, disrupting receptor-mediated transcriptional activation in vivo and in vitro PMID: 12077419
- TEP1, hTR, hsp90, p23, and dyskerin remained at high and unchanged levels throughout up- or down regulation of telomerase activity. PMID: 12135483
- acts in vivo to stabilize hsp90 binding to client protein [hsp90 cochaperone p23] PMID: 14507910
- A role proposed for co-chaperone p23 is to lock individual subunits of Hsp90 in an ATP-dependent conformational state that has a high affinity for client proteins. PMID: 16403413
- p23 differentially regulates ER target genes and is involved in the control of distinct cellular processes in breast tumor development PMID: 16809759
- Carbonyl reductase-1 (CBR1), microsomal prostaglandin E synthase-1 and 2 (mPGES-1, mPGES-2), cytosolic prostaglandin E synthase (cPGES), aldoketoreductase (AKR1C1) and prostaglandin F synthase (AKR1C3) were all expressed in hair follicles. PMID: 17697149
- all three terminal prostaglandin synthases, mPGES-1, mPGES-2, and cPGES, are over-expressed in human gliomas PMID: 19347995
- Overexpression of Delta p23 resulted in a decrease in hTERT levels, and a down-regulation in telomerase activity. PMID: 19740745