Recombinant Human Proprotein Convertase Subtilisin/Kexin Type 6 (PCSK6) Protein (hFc)
Beta LifeScience
SKU/CAT #: BLC-00250P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Proprotein Convertase Subtilisin/Kexin Type 6 (PCSK6) Protein (hFc)
Beta LifeScience
SKU/CAT #: BLC-00250P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Proprotein Convertase Subtilisin/Kexin Type 6 (PCSK6) Protein (hFc) is produced by our Mammalian cell expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P29122 |
Target Symbol | PCSK6 |
Species | Homo sapiens (Human) |
Expression System | Mammalian cell |
Tag | C-hFc |
Target Protein Sequence | REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQFCCRTCLLAG |
Expression Range | 860-969aa |
Protein Length | Partial |
Mol. Weight | 43.6 kDa |
Research Area | Neuroscience |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Serine endoprotease that processes various proproteins by cleavage at paired basic amino acids, recognizing the RXXX[KR]R consensus motif. Likely functions in the constitutive secretory pathway, with unique restricted distribution in both neuroendocrine and non-neuroendocrine tissues. |
Subcellular Location | [Isoform PACE4A-I]: Secreted.; [Isoform PACE4A-II]: Secreted.; [Isoform PACE4C]: Endoplasmic reticulum. Note=Not secreted, remains probably in zymogen form in endoplasmic reticulum.; [Isoform PACE4CS]: Endoplasmic reticulum. Note=Not secreted, remains probably in zymogen form in endoplasmic reticulum.; [Isoform PACE4E-I]: Endomembrane system; Peripheral membrane protein. Note=Retained intracellularly probably through a hydrophobic cluster in their C-terminus.; [Isoform PACE4E-II]: Endomembrane system; Peripheral membrane protein. Note=Retained intracellularly probably through a hydrophobic cluster in their C-terminus.; [Isoform PACE4B]: Secreted. |
Protein Families | Peptidase S8 family |
Database References | HGNC: 8569 OMIM: 167405 KEGG: hsa:5046 STRING: 9606.ENSP00000305056 UniGene: PMID: 29180304 |