Recombinant Human Promotilin (MLN) Protein (His-GST&Myc)
Beta LifeScience
SKU/CAT #: BLC-01513P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Promotilin (MLN) Protein (His-GST&Myc)
Beta LifeScience
SKU/CAT #: BLC-01513P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Promotilin (MLN) Protein (His-GST&Myc) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | P12872 |
Target Symbol | MLN |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-10His-GST&C-Myc |
Target Protein Sequence | FVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK |
Expression Range | 26-115aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 45.5 kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle. |
Subcellular Location | Secreted. |
Protein Families | Motilin family |
Database References |
Gene Functions References
- Hemodialysis improves upper GI symptoms and gastric slow waves in CKD patients. An increase in ghrelin and a decrease in GLP-1 might be involved in the HD-induced improvement in gastric slow waves. PMID: 28566304
- motilin-induced phase III contractions signal hunger in healthy subjects and that this system is disturbed in morbidly obese patients--{REVIEW} PMID: 26660537
- Motilin stimulates growth hormone secretion and regulates interdigestive migrating contractions and fasting motor patterns in the gastrointestinal tract. [REVIEW] PMID: 22632857
- Motilin may directly influence adipocyte functions by stimulating energy storage. PMID: 21771971
- Ghrelin covaried with motilin in plasma in irritable bowel syndrome (IBS) but not in plasma from healthy subjects. This suggests the two peptides act together in IBS. PMID: 20338210
- Plasma levels of motilin were studied in 16 untreated Celiac disease patients and in an age-matched control group of 18 healthy subjects by radioimmunoassay and by high-performance liquid chromatography (HPLC). PMID: 12732349
- Ghrelin and motilin are cosecreted from a prominent endocrine cell population in the small intestine. PMID: 17595255
- The abnormal excretion of hormonal factors is closely related to gallstone formation PMID: 18234640
- About 35.9% of the patients with a T tube after cholecystectomy and choledochotomy have duodenal-biliary reflux. Most of them have sphincter of Oddi hypomotility and the decreased level of plasma motilin and serum gastrin. PMID: 18609694