Recombinant Human Prominin-1 (PROM1) Protein (His)

Name: Recombinant Human Prominin-1 (PROM1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-04724P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, Cluster of differentiation (cd) proteins, Featured cd protein molecules, High-quality recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Prominin-1 (PROM1) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O43490
Target Symbol	PROM1
Synonyms	AC133; Antigen AC133; CD133; CORD12; Hematopoietic stem cell antigen; hProminin; MCDR2; MSTP061; OTTHUMP00000217744; OTTHUMP00000217745; OTTHUMP00000217746; PROM1; PROM1_HUMAN; Prominin I; Prominin like 1; Prominin like protein 1 precursor; Prominin mouse like 1; Prominin-1; Prominin-like protein 1; Prominin1; PROML1; RP41; STGD4
Species	Homo sapiens (Human)
Expression System	Yeast
Tag	N-6His
Target Protein Sequence	GANVEKLICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVDVFLCSYIIDPLN
Expression Range	508-792aa
Protein Length	Partial
Mol. Weight	34.2kDa
Research Area	Epigenetics And Nuclear Signaling
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	May play a role in cell differentiation, proliferation and apoptosis. Binds cholesterol in cholesterol-containing plasma membrane microdomains and may play a role in the organization of the apical plasma membrane in epithelial cells. During early retinal development acts as a key regulator of disk morphogenesis. Involved in regulation of MAPK and Akt signaling pathways. In neuroblastoma cells suppresses cell differentiation such as neurite outgrowth in a RET-dependent manner.
Subcellular Location	Apical cell membrane; Multi-pass membrane protein. Cell projection, microvillus membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment. Endoplasmic reticulum. Endoplasmic reticulum-Golgi intermediate compartment. Note=Found in extracellular membrane particles in various body fluids such as cerebrospinal fluid, saliva, seminal fluid and urine.
Protein Families	Prominin family
Database References	HGNC: 9454 OMIM: 603786 KEGG: hsa:8842 STRING: 9606.ENSP00000415481 UniGene: PMID: 30297396 Data show that pancreatic aldehyde dehydrogenase (ALDH(hi) cells contain a heterogeneous CD133-enriched population with a subset of beta-cell associated markers in the developing pancreas. PMID: 29285988 The downregulation of LIPC in the HepG2 cells was associated with the decreased expression of CD133, decreased cell proliferation and colony formation, as well as increased resistance to chemotherapy. PMID: 30015857 The expression of CD133 protein in patients with osteosarcoma was significantly high and related to the distant metastasis, which may be a potential prediction biomarker for poor prognosis of osteosarcoma patients PMID: 29970672 this present study shows a significant correlation between CD133 expression and differentiation of NSCLC both in our results and pooled previous results. CD133 may have prognostic significance for patients with NSCLC based on currently obtained data. PMID: 29758924 CD133 downregulation also suppressed iRFA-induced cell viability, invasion and autophagy. Collectively, our results indicated that RFA may promote residual HCC cell progression by autophagy and CD133 feedback loop. PMID: 29749472 CD133 staining was positive in 17.9% of the colorectal adenomas. Moreover, CD133 expression was associated with differentiation status (p = 0.003) and tumor size (p = 0.03). PMID: 28190751 CD133 expression and MYCN amplification induce chemoresistance and reduce average survival time in pediatric neuroblastoma. PMID: 29322842 Negative CD133 expression was an independent risk factor for a reduced disease-free survival in colon cancer with peritoneal metastasis. PMID: 29328371 this meta-analysis indicated both CD133 and Nestin expression were significantly associated with advanced FIGO stage, larger size of residual cancer in EOC patients. PMID: 29168665 Cytoplasmic and nuclear CD133 expression in colorectal adenocarcinoma cells and tumor microenvironment cells may play an important role in early colorectal adenocarcinoma carcinogenesis, while decreased CD133 nuclear expression in colorectal adenocarcinoma cells may contribute to colorectal adenocarcinoma metastasis. PMID: 30061254 CD133 expression may serve as a biomarker for early detection of gastric cancer. PMID: 30061208 Human UCB- CD133(+) hematopoietic stem cells into are remarkably potent cell candidates to transdifferentiate into motor neuron-like cells, in vitro PMID: 28754612 This study confirms that the CD133lo subset of Rb Y79 cell line is endowed with the characteristics of cancer stem cells as demonstrated by the in vitro functional assays and is in agreement with our previous findings in primary Rb tumors. PMID: 29162051 The expression of CD133 and SSEA4 determines the differentiation fate of pluripotent cancer stem cells. PMID: 28624968 CD133 is a useful predictive or prognostic biomarker for Colorectal cancer in clinical assessment and may serve as a potential therapeutic target for Colorectal cancer. PMID: 29879012 Bmi1 promoted invasion and migration of CD133+Hep G2 cells. PMID: 28849237 Lymph node metastasis is strongly associated with expression status of HGF and CD133 at the deep invasive front, suggesting the usefulness of these proteins as independent predictive markers of lymph node metastasis in early gastric cancer. PMID: 28595915 Higher hazard ratios for associations between CD133 rs2240688 polymorphism and overall survival (OS) were observed in patients with adjuvant chemotherapy and radiotherapy for curative intent. The study confirmed the significant association between the SNP rs2240688 A>C of CD133 and OS of non-small cell lung cancer patients. PMID: 28827262 glioma cells expressing CD133 are capable of modulating tumor microenvironment through the IL-1beta signaling pathway. PMID: 28736425 Exogenous CXCL3 induced Erk1/2 and ETS1 phosphorylation and promoted CD133 expression. PMID: 27255419 Low expressions of Oct4-EpCAM in IHC and CD133 in qPCR may reveal roles in gastric cancer PMID: 27557490 The clinical evidence that revealed cytoplasmic CD133 expression was correlated with poor prognosis, while nuclear CD133 expression was significantly correlated with favorable prognosis. PMID: 28687090 High CD133 expression is associated with Basal Breast Cancers. PMID: 28216417 In conclusion, p-STAT3 may participate in the progression of the early stage of colon cancer through the up-regulation of CD133, which in turn induces survivin expression. However, the regulatory mechanism of these molecules in tumor progression in vivo is need to be more verified. PMID: 29432737 Circulating tumor cells expressing cytokeratin and tumor-initiating cell markers, including ALDH, CD133, and CD44, were identified in patients with pancreatic adenocarcinoma. These TIC-like CTCs were associated with poor prognosis after surgical resection and with an increased incidence of tumor recurrence PMID: 27789528 High CD133 expression is associated with renal cell carcinoma. PMID: 27588469 CD133+CD24lo phenotype defines 5-FU-resistant human colon cancer stem cell-like cells. PMID: 27659530 Intraperitoneal enrichment of cancer stem-like cells, from ovarian cancer cell lines or primary ovarian tumor, provides a rational approach for cancer stem-like cell isolation and characterization using CD44 and prominin-1(CD133) as selection markers. PMID: 27655682 CD133 may have different roles in survival from non-small-cell lung cancer based on ethnic groups [meta-analysis] PMID: 27489355 Notch1 signaling plays an important role in the maintenance of the cancer stem-like phenotype in diffuse type gastric cancer through an RBP-Jkappa dependent pathway; inhibiting Notch1 signaling could be an effective therapy against CD133 positive diffuse type gastric cancers PMID: 27489358 Low CD133 Expression is associated with Recurrence in Colorectal Cancer with Synchronous Liver Metastasis. PMID: 26832881 CD133+ cells were genetically heterogeneous among patients without any defined profile compared to CD133-/EpCAM+ cells. PMID: 28347289 Results show that CD133 and MDR1 expression increase in recurrent pediatric pilocytic astrocytomas (PAs) following chemotherapy, and in drug resistant tumor cells. CD133 regulates MDR1 expression via the PI3K/AKT/NF-kappaB signaling. These results provide evidence that CD133 contributes to multidrug resistance by regulating MDR1 levels via the PI3K-Akt-NF-kappaB signal pathway. PMID: 28137267 CD133(+) CD44(+) CD54(+) cellular subpopulation of circulating tumor cells has a prognostic value in colorectal cancer patients with liver metastasis, especially in the survival of CRC patients with liver metastasis who did not undergo surgical treatment for metastasis. PMID: 29105339 High CD133 expression is associated with radioresistance in liver cancer. PMID: 26993601 CD133+ glioblastoma cells express molecular signatures of MSCs, neural stem cells and pluripotent stem cell PMID: 27244897 These findings indicate a novel potential anti-tumor mechanism for tubacin in CD133-expressing malignancies. PMID: 28452069 CD133 expression in colonic liver metastases is a negative prognostic factor for disease-free survival after liver resection. PMID: 29277789 The study found a significant association between the SNP rs2240688A[C of CD133 and lung cancer risk. PMID: 27130457 Results strongly indicate functional roles for CD133 in reactive oxygen species defense and in evading anticancer therapies in hepatocellular carcinoma. PMID: 28253902 High CD133 expression is associated with clear cell renal cell carcinoma. PMID: 29050853 This study described three cases in which variations in PROM1 gene may play a role in the pathogenesis of macular dystrophy or be associated with both autosomal recessive and autosomal dominant inheritance. PMID: 28095140 CD133 polymorphisms are promising biomarkers for genetic susceptibility and prognosis prediction of gastric cancer. PMID: 28326835 Low CD133 expression is associated with gastric cancer. PMID: 28218426 Our results strongly suggest epigenetic regulation of CD133 expression by promoter methylation in gastrointestinal stromal tumors PMID: 28398518 Taken together, these findings show that elevated levels of CD133 lead to Oral squamous cell carcinoma (OSCC)invasiveness and metastasis, associated with the upregulation of EMT and stemness markers. PMID: 27137188 CD133 and CD44 in glioblastoma stem cells have roles in cell proliferation, phenotype stability and intra-tumor heterogeneity PMID: 28241049 The combination of CD133 phenotyping and World Health Organization grading may assist in stratifying patients with well-differentiated pancreatic neuroendocrine tumors. PMID: 27864124 CD133 facilitates cancer stem cell-like properties by stabilizing EGFR-AKT signaling in HCC. PMID: 28034805

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.