Recombinant Human Prohibitin-2 (PHB2) Protein (GST)

Name: Recombinant Human Prohibitin-2 (PHB2) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-08735P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins, Recombinant proteins fall special offers - full-length proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Prohibitin-2 (PHB2) Protein (GST) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q99623
Target Symbol	PHB2
Synonyms	B cell receptor associated protein BAP37; B-cell receptor-associated protein BAP37; BAP; Bap37; BCAP 37; D prohibitin; D-prohibitin; p22; Phb2; PHB2_HUMAN; PNAS 141; Prohibitin 2; Prohibitin-2; Repressor of estrogen receptor activity
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
Expression Range	1-299aa
Protein Length	Full Length
Mol. Weight	60.2kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Protein with pleiotropic attributes mediated in a cell-compartment- and tissue-specific manner, which include the plasma membrane-associated cell signaling functions, mitochondrial chaperone, and transcriptional co-regulator of transcription factors and sex steroid hormones in the nucleus.; In the mitochondria, together with PHB, forms large ring complexes (prohibitin complexes) in the inner mitochondrial membrane (IMM) and functions as chaperone protein that stabilizes mitochondrial respiratory enzymes and maintains mitochondrial integrity in the IMM, which is required for mitochondrial morphogenesis, neuronal survival, and normal lifespan (Probable). The prohibitin complex, with DNAJC19, regulates cardiolipin remodeling and the protein turnover of OMA1 in a cardiolipin-binding manner. Also regulates cytochrome-c oxidase assembly (COX) and mitochondrial respiration. Binding to sphingoid 1-phosphate (SPP) modulates its regulator activity. Has a key role of mitophagy receptor involved in targeting mitochondria for autophagic degradation. Involved in mitochondrial-mediated antiviral innate immunity, activates DDX58/RIG-I-mediated signal transduction and production of IFNB1 and proinflammatory cytokine IL6.; In the nucleus, serves as transcriptional co-regulator (Probable). Acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases. Functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. Competes with NCOA1 for modulation of ER transcriptional activity.; In the plasma membrane, is involved in IGFBP6-induced cell migration. Cooperates with CD86 to mediate CD86-signaling in B lymphocytes that regulates the level of IgG1 produced through the activation of distal signaling intermediates. Upon CD40 engagement, required to activate NF-kappa-B signaling pathway via phospholipase C and protein kinase C activation.; (Microbial infection) Involved in human enterovirus 71/EV-71 infection by enhancing the autophagy mechanism during the infection.
Subcellular Location	Mitochondrion inner membrane. Cytoplasm. Nucleus. Cell membrane.; [Isoform 1]: Mitochondrion inner membrane.; [Isoform 2]: Mitochondrion inner membrane.
Protein Families	Prohibitin family
Database References	HGNC: 30306 OMIM: 610704 KEGG: hsa:11331 STRING: 9606.ENSP00000441875 UniGene: PMID: 29367618 the present study suggested that PHB2 may promote Prostate cancer cell migration by inhibiting the expression of AKT2. These results provide information regarding the role of PHB2 in Prostate cancer migration and malignancy PMID: 29207197 Taken together, the results indicate that PHB2 plays a central role in p21 upregulation following GGCT knockdown and as such may promote deregulated proliferation of cancer cells by suppressing p21. PMID: 29307834 analysis of LGALS3, PHB2, MUC1, and GK2 expression with CA15-3 in early-stage breast cancer PMID: 26289852 REA modulates cross talk among multiple cell types in the uterine tissue and host background, serving as a brake on the estradiol-ER axis and restraining multiple aspects that contribute to the pathologic progression of endometriosis. PMID: 26653759 results show that PHB2 binds to the ligand binding domain of ERalpha with a conformational change in the helix 12 of ERalpha PMID: 26049107 Functional analysis of selected regulated proteins revealed that knockdown of HNRPD, PHB2 and UB2V2 can increase HCMV replication, while knockdown of A4 and KSRP resulted in decreased HCMV replication. PMID: 25910425 These results demonstrate that estradiol upregulates REA expression and recruits REA via ERalpha to the EREs on the RORgammaT promoter region, thus inhibiting RORgammaT expression and Th17 differentiation. PMID: 25769926 BIG3 (ARFGEF3) is predicted to interact with its partner PHB2 through an ARM-type alpha-helical structure. PMID: 24997568 Data indicate that the up-regulated expression of prohibitin promoted acute promyelocytic leukemia cell line NB4-R1 cell apoptosis. PMID: 25200157 PHB2 in hepatocellular carcinoma supports the development and progression of hepatocellular malignancy. PMID: 23661548 Prohibitin 2 acts as a nuclear AKT substrate during all-trans retinoic acid-induced differentiation of acute promyelocytic leukemia cells PMID: 24522204 prohibitin and prohibiton (PHB2) contribute to PIG3-mediated apoptosis by binding to the PIG3 promoter (TGYCC)15 motif PMID: 24388982 Data indicate that IGFBP-6 binds to prohibitin-2 on the cell membrane, and knockdown of the latter abrogates IGFBP-6-induced migration. PMID: 24003225 Data demonstrate that PHB2 is essential for metabolic activation of mitochondria and, as a consequence, for function and survival of beta-cells. PMID: 23863811 ASURA specifically binds to chromatin when Scc1 is associated with chromatin. PMID: 23548868 PHBs are localized on the human platelet membrane and are involved in PAR1-mediated platelet aggregation. PMID: 22212092 REA physiologically restrains endometrial stromal cell decidualization, controlling the timing and magnitude of decidualization to coordinate uterine differentiation with concurrent embryo development that is essential for implantation and fertility. PMID: 23392257 Casein kinase 1 proteomics reveal prohibitin 2 function in molecular clock PMID: 22384121 Prohibitin 1 and 2 are required for cancer cell proliferation and adhesion. PMID: 20856874 results point to binding of the Phb1/Phb2 complex to the Env-CT as being of importance for replicative spread in nonpermissive cells, possibly by modulating critical Phb-dependent cellular process(es) PMID: 19906925 REA has a role as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases PMID: 15140878 mammalian PHB2 has roles in mitochondria and its nuclear translocation is estrogen receptor-dependent PMID: 17008324 EZH2 regulates the transcription of estrogen-responsive genes through association with REA, an estrogen receptor corepressor PMID: 17453341 Findings suggest that, in addition to the shugoshin, PHB2 is also required to protect the centromeric cohesion from phosphorylation by Plk1 during early mitosis and that its function is essential for proper mitotic progression. PMID: 17656096 SKP2 variant Skp2B interacts with the repressor of estrogen receptor activity (REA) and that overexpression of Skp2B leads to a reduction in REA levels. PMID: 17785450 Results demonstrate that the repressor of estrogen receptor activity (REA), a protein related to PHB, interacts with PHB, to form heteromers and enhance the protein stability of both corepressors. PMID: 17932104 Phb1 and Phb2 are novel phosphoproteins up-regulated during T cell activation that function to maintain mitochondrial integrity PMID: 18086671 a novel mechanism by which RNF2 and PHB2 modulate the CP2-mediated transcriptional pathway. PMID: 18629613 Estradiol downregulation of the tumor suppressor gene BTG2 requires estrogen receptor-alpha and the REA corepressor PMID: 19117054 Severe acute respiratory syndrome coronavirus nonstructural protein 2 interacts with a host protein complex of PHB1 and PHB2 involved in mitochondrial biogenesis and intracellular signaling PMID: 19640993

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.