Recombinant Human Proheparin-Binding Egf-Like Growth Factor (HBEGF) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07977P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Proheparin-Binding Egf-Like Growth Factor (HBEGF) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-07977P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Proheparin-Binding Egf-Like Growth Factor (HBEGF) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q99075 |
| Target Symbol | HBEGF |
| Synonyms | diphtheria toxin receptor (heparin-binding EGF-like growth factor); diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor); Diphtheria toxin receptor; DT R; DT-R; DTR; DTS; DTSF; HB-EGF; HBEGF; HBEGF_HUMAN; HEGFL; Heparin binding EGF like growth factor; Heparin binding epidermal growth factor; Heparin binding epidermal growth factor like growth factor; Heparin-binding EGF-like growth factor; Proheparin binding EGF like growth factor |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | C-6His |
| Target Protein Sequence | DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL |
| Expression Range | 63-148aa |
| Protein Length | Partial |
| Mol. Weight | 11.7 kDa |
| Research Area | Cancer |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor. |
| Subcellular Location | [Heparin-binding EGF-like growth factor]: Secreted, extracellular space. Note=Mature HB-EGF is released into the extracellular space and probably binds to a receptor.; [Proheparin-binding EGF-like growth factor]: Cell membrane; Single-pass type I membrane protein. |
| Database References | HGNC: 3059 OMIM: 126150 KEGG: hsa:1839 STRING: 9606.ENSP00000230990 UniGene: PMID: 28746898 |
