Recombinant Human Programmed Cell Death 1 Ligand 2 (PDCD1LG2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08917P
Greater than 85% as determined by SDS-PAGE.
Recombinant Human Programmed Cell Death 1 Ligand 2 (PDCD1LG2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-08917P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Programmed Cell Death 1 Ligand 2 (PDCD1LG2) Protein (His) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Uniprotkb | Q9BQ51 |
| Target Symbol | PDCD1LG2 |
| Synonyms | B7 dendritic cell molecule; B7-DC; B7DC; bA574F11.2; Btdc; Butyrophilin B7 DC; Butyrophilin B7-DC; Butyrophilin B7DC ; CD 273; CD273; CD273 antigen ; MGC142238; MGC142240; PD 1 ligand 2; PD L2; PD-1 ligand 2; PD-L2; PD1 ligand 2; PD1L2_HUMAN; PDCD 1 ligand 2; PDCD1 ligand 2; PDCD1L2; Pdcd1lg2; PDL 2; PDL2; Programmed cell death 1 ligand 2; Programmed death ligand 2 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | FTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGKASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLK |
| Expression Range | 21-118aa |
| Protein Length | Partial |
| Mol. Weight | 15.1 kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production. |
| Subcellular Location | [Isoform 3]: Secreted.; [Isoform 2]: Endomembrane system; Single-pass type I membrane protein.; [Isoform 1]: Cell membrane; Single-pass type I membrane protein. |
| Protein Families | Immunoglobulin superfamily, BTN/MOG family |
| Database References | HGNC: 18731 OMIM: 605723 KEGG: hsa:80380 STRING: 9606.ENSP00000380855 UniGene: PMID: 29122656 |
