Recombinant Human Probable Jmjc Domain-Containing Histone Demethylation Protein 2C (JMJD1C) Protein (His-SUMO&Myc)

Name: Recombinant Human Probable Jmjc Domain-Containing Histone Demethylation Protein 2C (JMJD1C) Protein (His-SUMO&Myc)
Brand: Beta LifeScience
SKU: BLC-02543P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Probable Jmjc Domain-Containing Histone Demethylation Protein 2C (JMJD1C) Protein (His-SUMO&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q15652
Target Symbol	JMJD1C
Synonyms	JHD2C_HUMAN; Jmjd1c; Jumonji domain containing 1C ; Jumonji domain-containing protein 1C; Probable JmjC domain-containing histone demethylation protein 2C; Thryoid receptor interacting protein; Thyroid receptor-interacting protein 8; TR-interacting protein 8; TRIP-8; TRIP8
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His-SUMO&C-Myc
Target Protein Sequence	MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELR
Expression Range	2274-2498aa
Protein Length	Partial
Mol. Weight	45.5kDa
Research Area	Epigenetics And Nuclear Signaling
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Probable histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Demethylation of Lys residue generates formaldehyde and succinate. May be involved in hormone-dependent transcriptional activation, by participating in recruitment to androgen-receptor target genes.
Subcellular Location	Nucleus.
Protein Families	JHDM2 histone demethylase family
Database References	HGNC: 12313 OMIM: 604503 KEGG: hsa:221037 STRING: 9606.ENSP00000382204 UniGene: PMID: 28406950 JMJD1C is one of the target genes of hsa-miR-590- 3p. PMID: 27064872 Our findings indicate that mutations in JMJD1C contribute to the development of Rett syndrome and intellectual disability. PMID: 26181491 genetic variants in the androgen-related genes CYP17A1 and JMJD1C might be associated with risk of Barrett's esophagus (BE) and esophageal adenocarcinoma (EAC). PMID: 26414697 Histone modifier genes (JMJD1C, RREB1, MINA, KDM7A) alter conotruncal heart phenotypes in 22q11.2 deletion syndrome. PMID: 26608785 JMJD1C is directly recruited by RUNX1-RUNX1T1 to its target genes and regulates their expression by maintaining low H3K9 dimethyl (H3K9me2) levels PMID: 26494788 Depletion of JMJD1C impairs expansion and colony formation of leukemic cell lines, with the strongest effect observed in the MLL-rearranged ALL cell line SEM. PMID: 24501218 JMJD1C represses neural differentiation of hESCs at least partially by epigenetically sustaining miR-302 expression PMID: 24318875 JMJD1C regulates the RAP80-BRCA1 branch of this DNA-damage response (DDR) pathway. PMID: 24240613 No evidence for JMJD1C histone demethylase activity towards H3K9. PMID: 23593242 Observational study of gene-disease association. (HuGE Navigator) PMID: 20648472 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 20526338 TRIP8 gene codes for a protein predicted to be a transcriptional regulator associated with nuclear thyroid hormone receptors. Positional candidate gene for autism. PMID: 17290275 the discovery of a new Receptors, Androgen coactivator which belongs to the JmjC containing enzyme family as a novel variant of JMJD1C PMID: 17353003 Human JMJD1C variant 2 with TRI8H1, TRI8H2, and JmjC domains showed 85.7% total-amino-acid identity with mouse Jmjd1c. PMID: 17549425 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 19936222 Observational study of gene-disease association. (HuGE Navigator) PMID: 16385451 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator) PMID: 18940312

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.