Recombinant Human Pro-Neuregulin-2, Membrane-Bound Isoform (NRG2) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09167P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Pro-Neuregulin-2, Membrane-Bound Isoform (NRG2) Protein (His-SUMO)
Beta LifeScience
SKU/CAT #: BLC-09167P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Pro-Neuregulin-2, Membrane-Bound Isoform (NRG2) Protein (His-SUMO) is produced by our E.coli expression system. This is a extracellular protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O14511 |
| Target Symbol | NRG2 |
| Synonyms | Divergent of neuregulin 1; Divergent of neuregulin-1; Don 1; DON-1; Neural- and thymus-derived activator for ERBB kinases; Neuregulin 2; Neuregulin-2; NRG-2; Nrg2; NRG2_HUMAN; NTAK; Pro NRG2; Pro-NRG2 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-SUMO |
| Target Protein Sequence | CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKR |
| Expression Range | 112-405aa |
| Protein Length | Extracellular Domain |
| Mol. Weight | 48.8kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor. |
| Subcellular Location | [Pro-neuregulin-2, membrane-bound isoform]: Cell membrane; Single-pass type I membrane protein.; [Neuregulin-2]: Secreted. |
| Protein Families | Neuregulin family |
| Database References | HGNC: 7998 OMIM: 603818 KEGG: hsa:9542 STRING: 9606.ENSP00000354910 UniGene: PMID: 27345716 |
