Recombinant Human Pro-Neuregulin-1, Membrane-Bound Isoform (NRG1), Active
Beta LifeScience
SKU/CAT #: BLC-05596P

Greater than 95% as determined by SDS-PAGE.
Recombinant Human Pro-Neuregulin-1, Membrane-Bound Isoform (NRG1), Active
Beta LifeScience
SKU/CAT #: BLC-05596P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Pro-Neuregulin-1, Membrane-Bound Isoform (NRG1), Active is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined in a serum-free cell proliferation assay using MCF-7 human breast cancer cells is less than 3 ng/mL. |
Uniprotkb | Q02297 |
Target Symbol | NRG1 |
Synonyms | Acetylcholine receptor-inducing activity; Acetylcholine receptor-inducing activity, chick, homolog of; ARIA; Breast cancer cell differentiation factor p45; GGF; GGF2; glial growth factor 2; Glial growth factor; Heregulin; heregulin, alpha (45kD, ERBB2 p185-activator); heregulin, alpha; HGL; HRG; HRG1; HRGA; MST131; MSTP131; NDF; Neu differentiation factor; Neuregulin-1; nrg1; NRG1-IT2; NRG1_HUMAN; Pro-NRG1; Sensory and motor neuron-derived factor; SMDF |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | Tag-Free |
Complete Sequence | SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE |
Expression Range | 177-241aa |
Protein Length | Partial of Isoform 6 |
Mol. Weight | 7.5 kDa |
Research Area | Neuroscience |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. The multiple isoforms perform diverse functions such as inducing growth and differentiation of epithelial, glial, neuronal, and skeletal muscle cells; inducing expression of acetylcholine receptor in synaptic vesicles during the formation of the neuromuscular junction; stimulating lobuloalveolar budding and milk production in the mammary gland and inducing differentiation of mammary tumor cells; stimulating Schwann cell proliferation; implication in the development of the myocardium such as trabeculation of the developing heart. Isoform 10 may play a role in motor and sensory neuron development. Binds to ERBB4. Binds to ERBB3. Acts as a ligand for integrins and binds (via EGF domain) to integrins ITGAV:ITGB3 or ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and ERRB3 are essential for NRG1-ERBB signaling. Induces the phosphorylation and activation of MAPK3/ERK1, MAPK1/ERK2 and AKT1. Ligand-dependent ERBB4 endocytosis is essential for the NRG1-mediated activation of these kinases in neurons. |
Subcellular Location | [Pro-neuregulin-1, membrane-bound isoform]: Cell membrane; Single-pass type I membrane protein. Note=Does not seem to be active.; [Neuregulin-1]: Secreted.; [Isoform 8]: Nucleus. Note=May be nuclear.; [Isoform 9]: Secreted. Note=Has a signal peptide.; [Isoform 10]: Membrane; Single-pass type I membrane protein. Note=May possess an internal uncleaved signal sequence. |
Protein Families | Neuregulin family |
Database References | HGNC: 7997 OMIM: 142445 KEGG: hsa:3084 STRING: 9606.ENSP00000349275 UniGene: PMID: 28496106 |