Recombinant Human Pro-Epidermal Growth Factor (EGF), Active
Beta LifeScience
SKU/CAT #: BLC-05958P
Greater than 95% as determined by SDS-PAGE.
Recombinant Human Pro-Epidermal Growth Factor (EGF), Active
Beta LifeScience
SKU/CAT #: BLC-05958P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Pro-Epidermal Growth Factor (EGF), Active is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined by the dose-dependent proliferation of murine BALB/c 3T3 cells is typically 0.1-0.5 ng/ml |
| Uniprotkb | P01133 |
| Target Symbol | EGF |
| Synonyms | Beta urogastrone; beta-urogastrone; EGF; EGF_HUMAN; Epidermal growth factor; HOMG4; OTTHUMP00000219721; OTTHUMP00000219722; Pro epidermal growth factor; URG; Urogastrone |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | Tag-Free |
| Complete Sequence | NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
| Expression Range | 971-1023aa |
| Protein Length | Partial |
| Mol. Weight | 6.2 kDa |
| Research Area | Signal Transduction |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm Filtered 20 mM Tris-HCl, 200 mM NaCl, pH 8.0 |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6. Can induce neurite outgrowth in motoneurons of the pond snail Lymnaea stagnalis in vitro. |
| Subcellular Location | Membrane; Single-pass type I membrane protein. |
| Database References | HGNC: 3229 OMIM: 131530 KEGG: hsa:1950 STRING: 9606.ENSP00000265171 UniGene: PMID: 30226622 |
