Recombinant Human Prkca-Binding Protein (PICK1) Protein (GST)

Name: Recombinant Human Prkca-Binding Protein (PICK1) Protein (GST)
Brand: Beta LifeScience
SKU: BLC-08423P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Prkca-Binding Protein (PICK1) Protein (GST) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q9NRD5
Target Symbol	PICK1
Synonyms	dJ1039K5; MGC15204; OTTHUMP00000028509; PICK 1; Pick1; PICK1_HUMAN; PRKCA binding protein; PRKCA-binding protein; PRKCABP; Protein interacting with C kinase 1; Protein interacting with PRKCA; Protein interacting with PRKCA 1; Protein kinase C alpha binding protein; Protein kinase C-alpha-binding protein; Protein that interacts with C kinase 1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-GST
Target Protein Sequence	MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQ
Expression Range	1-200aa
Protein Length	Partial
Mol. Weight	48.9kDa
Research Area	Signal Transduction
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Probable adapter protein that bind to and organize the subcellular localization of a variety of membrane proteins containing some PDZ recognition sequence. Involved in the clustering of various receptors, possibly by acting at the receptor internalization level. Plays a role in synaptic plasticity by regulating the trafficking and internalization of AMPA receptors. May be regulated upon PRKCA activation. May regulate ASIC1/ASIC3 channel. Regulates actin polymerization by inhibiting the actin-nucleating activity of the Arp2/3 complex; the function is competetive with nucleation promoting factors and is linked to neuronal morphology regulation and AMPA receptor (AMPAR) endocytosis. Via interaction with the Arp2/3 complex involved in regulation of synaptic plasicity of excitatory synapses and required for spine shrinkage during long-term depression (LTD). Involved in regulation of astrocyte morphology, antagonistic to Arp2/3 complex activator WASL/N-WASP function.
Subcellular Location	Cytoplasm, perinuclear region. Membrane; Peripheral membrane protein. Membrane; Lipid-anchor. Cell junction, synapse, postsynaptic density. Cell junction, synapse, synaptosome. Cytoplasm, cytoskeleton.
Database References	HGNC: 9394 OMIM: 605926 KEGG: hsa:9463 STRING: 9606.ENSP00000349465 UniGene: PMID: 28507309 Coincident with the loss of PICK1 by GBF1-activated ARF1, CDC42 recruitment leads to the activation of IRSp53 and the ARP2/3 complex, resulting in a burst of F-actin polymerisation potentially powering scission. PMID: 29743604 PICK1 is a cargo-specific endocytic accessory protein required for efficient, activity-dependent AMPAR endocytosis. PMID: 28855251 Our results demonstrate that downregulation of PICK1 elicited by miR-210-3p overexpression activates the TGF-b pathway, which further promotes bone metastasis in PCa, indicating that the miR- 210-3p/PICK1/TGF-b signalling axis plays an important role in PCa bone metastasis. PMID: 28697177 This study defines a novel mechanism whereby elevated [Ca(2+)] induced by NMDA receptor activation modulates Ago2 and miRNA activity via PICK1. Our work suggests a Ca(2+)-dependent process to regulate miRNA activity in neurons in response to the induction of long-term depression. PMID: 28404816 We propose that PICK1 negatively regulates neoplastic infiltration of astrocytic tumors and that manipulation of PICK1 is an attractive possibility for therapeutic intervention PMID: 26466675 PICK1 domain ACT links PICK1-associated vesicles to a motility factor, likely myosin, but, contrary to previous reports, PICK1 neither binds nor inhibits Arp2/3 complex. PMID: 25657323 Unlike accessory domains in other BAR domain proteins, the positioning of the PDZ domains is flexible, enabling PICK1 to perform long-range, dynamic scaffolding of membrane-associated proteins. PMID: 26073603 Data indicate three principal binding modes can account for protein interacting with C-kinase 1 (PICK1) PDZ domains binding specificity. PMID: 25023278 PICK1 promotes Ago2 localization at endosomal compartments in neuronal dendrites and inhibits Ago2 function in translational repression following neuronal stimulation. PMID: 24723684 These data indicate that Pick1 is involved in regulating the cell-cell junction in epithelial cells. PMID: 24937449 C-terminal domain of ICA69 interacts with PICK1 and acts on trafficking of PICK1-PKCalpha complex and cerebellar plasticity. PMID: 24358315 Family-based association study failed to observe a statistically significant association for any of the genotyped SNPs in the PICK1 gene and attention-deficit hyperactivity disorder. PMID: 22436349 PICK1 increases caveolin-mediated endocytosis, ubiquitination and degradation of TGF-beta type I receptor. PMID: 22710801 The binding affinities of all major PICK1 interacting proteins are reported and the effects of PICK1 mutations on these interactions are described. PMID: 22275068 PICK1 is a suppressor of spinocerebellar ataxia 3-associated neurodegeneration. PMID: 21949352 Neph proteins and PICK1 synergistically regulate cell recognition and contact formation; Binding required dimerization of PICK1, was dependent on PDZ domain protein interactions, and mediated stabilization of Neph1 at the plasma membrane. PMID: 21690291 we have identified a homozygous mutation in the PICK1 gene that is associated with globozoospermia in humans PMID: 20562896 The PICK1 mRNA is elevated in patient with schizophrenia. PMID: 20385472 Protein interacting with C alpha kinase 1 (PICK1) is involved in promoting tumor growth and correlates with poor prognosis of human breast cancer. PMID: 20384629 Results describe the first small-molecule inhibitor (FSC231) of the PDZ domain in PICK1, which binds the PICK1 PDZ domain with an affinity similar to that observed for endogenous peptide ligands. PMID: 20018661 binding with glutamate receptor subtype PMID: 11891216 The PICK1 rs3952 polymorphism was genotyped in schizophrenia and controls. Results demonstrated that the PICK1 rs3952 genotype and allele distribution was significantly different between the two groups. PMID: 15305146 PICK-1 could be involved in the regulation of both adherens and tight junctions in epithelial cells PMID: 15811349 In a case-control association study, an association of the PICK1 gene with schizophrenia (SZ) was seen, which is more prominent in disorganized SZ. Findings implicating PICK1 are consistent with a role for D-serine in the disease. PMID: 16314870 polymorphisms of the PICK1 gene identified thus far are unlikely to contribute to genetic susceptibility to schizophrenia in the Japanese population PMID: 17367885 findings suggest that the PICK1 gene may be implicated in the susceptibility to spontaneous relapse of methamphetamine psychosis and that, as an intracellular adapter protein, PICK1 may play a role in the pathophysiology of methamphetamine psycho PMID: 17606663 PICK1 synaptic targeting requires direct interaction between the PDZ domain and lipid membranes PMID: 17914463 KRIP6 regulates kainate receptors by inhibiting PICK1 modulation via competition or a mutual blocking effect PMID: 18692513

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.