Recombinant Human Prefoldin Subunit 5 (PFDN5) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03615P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Prefoldin Subunit 5 (PFDN5) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03615P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Prefoldin Subunit 5 (PFDN5) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q99471 |
| Target Symbol | PFDN5 |
| Synonyms | 1190001O17Rik; 1700010A06Rik; c myc binding protein; c-myc binding protein MM 1; C-myc-binding protein Mm-1; D15Ertd697e; EIG 1; Eig1; MGC5329; MGC71907; MM 1; MM1; Myc modulator 1; PFD5; PFD5_HUMAN; PFDN5; Prefoldin 5; Prefoldin subunit 5 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | AQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA |
| Expression Range | 2-154aa |
| Protein Length | Full Length of Mature Protein |
| Mol. Weight | 44.2kDa |
| Research Area | Epigenetics And Nuclear Signaling |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins. Represses the transcriptional activity of MYC. |
| Subcellular Location | [Isoform 1]: Nucleus.; [Isoform 2]: Cytoplasm.; [Isoform 3]: Nucleus. |
| Protein Families | Prefoldin subunit alpha family |
| Database References | HGNC: 8869 OMIM: 604899 KEGG: hsa:5204 STRING: 9606.ENSP00000334188 UniGene: PMID: 26288249 |
