Recombinant Human Pre-Mrna-Splicing Factor Spf27 (BCAS2) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03929P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Pre-Mrna-Splicing Factor Spf27 (BCAS2) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-03929P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Pre-Mrna-Splicing Factor Spf27 (BCAS2) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | O75934 |
| Target Symbol | BCAS2 |
| Synonyms | bcas2; Breast carcinoma amplified sequence 2; Breast carcinoma-amplified sequence 2; DAM 1; DAM-1; DAM1; DNA amplified in mammary carcinoma 1 protein; MGC7712; Pre mRNA splicing factor SPF27; Pre-mRNA-splicing factor spf27; Snt309; SPF27; SPF27_HUMAN; Spliceosome associated protein amplified in breast cancer; Spliceosome associated protein SPF 27; Spliceosome-associated protein SPF 27 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF |
| Expression Range | 1-225aa |
| Protein Length | Full Length |
| Mol. Weight | 53.0kDa |
| Research Area | Tags & Cell Markers |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Required for pre-mRNA splicing as component of the activated spliceosome. Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. May have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex. The PRP19-CDC5L complex may also play a role in the response to DNA damage (DDR). |
| Subcellular Location | Nucleus. Nucleus, nucleolus. |
| Protein Families | SPF27 family |
| Database References | HGNC: 975 OMIM: 605783 KEGG: hsa:10286 STRING: 9606.ENSP00000358554 UniGene: PMID: 29115564 |
