Recombinant Human Pou Domain, Class 5, Transcription Factor 1 (POU5F1) Protein (His-B2M)
Beta LifeScience
SKU/CAT #: BLC-03507P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Pou Domain, Class 5, Transcription Factor 1 (POU5F1) Protein (His-B2M)
Beta LifeScience
SKU/CAT #: BLC-03507P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Pou Domain, Class 5, Transcription Factor 1 (POU5F1) Protein (His-B2M) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q01860 |
| Target Symbol | POU5F1 |
| Synonyms | Octamer binding transcription factor 4; MGC22487; Oct 3; Oct 4; Oct-3; Oct-4; OCT3; Oct4; Octamer binding protein 3; Octamer binding protein 4; Octamer binding transcription factor 3; Octamer-binding protein 3; Octamer-binding protein 4; Octamer-binding transcription factor 3; OTF 3; OTF 4; OTF-3; OTF3; OTF4; PO5F1_HUMAN; POU class 5 homeobox 1; POU domain class 5 transcription factor 1; POU domain transcription factor OCT4; POU domain, class 5, transcription factor 1; POU-type homeodomain-containing DNA-binding protein; POU5F1 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His-B2M |
| Target Protein Sequence | MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN |
| Expression Range | 1-360aa |
| Protein Length | Full Length |
| Mol. Weight | 52.6kDa |
| Research Area | Epigenetics And Nuclear Signaling |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 or SOX15 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency. |
| Subcellular Location | Cytoplasm. Nucleus. |
| Protein Families | POU transcription factor family, Class-5 subfamily |
| Database References | HGNC: 9221 OMIM: 164177 KEGG: hsa:5460 STRING: 9606.ENSP00000259915 UniGene: PMID: 29526821 |
