Recombinant Human Pou Domain Class 2-Associating Factor 1 (POU2AF1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10044P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Pou Domain Class 2-Associating Factor 1 (POU2AF1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10044P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Pou Domain Class 2-Associating Factor 1 (POU2AF1) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q16633 |
| Target Symbol | POU2AF1 |
| Synonyms | B cell Oct binding protein 1; B cell specific coactivator OBF 1; B cell specific coactivator OBF1; B-cell-specific coactivator OBF-1; BOB 1; BOB-1; OBF 1; OBF1; OBF1_HUMAN; OCA B; OCA-B; OCAB; OCT binding factor 1; OCT-binding factor 1; POU class 2 associating factor 1; POU domain class 2 associating factor 1; POU domain class 2-associating factor 1; Pou2af1 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-6His |
| Target Protein Sequence | MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF |
| Expression Range | 1-256aa |
| Protein Length | Full Length |
| Mol. Weight | 31.4kDa |
| Research Area | Transcription |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Transcriptional coactivator that specifically associates with either POU2F1/OCT1 or POU2F2/OCT2. It boosts the POU2F1/OCT1 mediated promoter activity and to a lesser extent, that of POU2F2/OCT2. It has no intrinsic DNA-binding activity. It recognizes the POU domains of POU2F1/OCT1 and POU2F2/OCT2. It is essential for the response of B-cells to antigens and required for the formation of germinal centers. Regulates IL6 expression in B cells as POU2F2/OCT2 coactivator. |
| Subcellular Location | Nucleus. |
| Protein Families | POU2AF1 family |
| Database References | HGNC: 9211 OMIM: 601206 KEGG: hsa:5450 STRING: 9606.ENSP00000376786 UniGene: PMID: 29496744 |
