Recombinant Human Pou Domain Class 2-Associating Factor 1 (POU2AF1) Protein (His)

Name: Recombinant Human Pou Domain Class 2-Associating Factor 1 (POU2AF1) Protein (His)
Brand: Beta LifeScience
SKU: BLC-10044P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Product Overview

Description	Recombinant Human Pou Domain Class 2-Associating Factor 1 (POU2AF1) Protein (His) is produced by our E.coli expression system. This is a full length protein.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q16633
Target Symbol	POU2AF1
Synonyms	B cell Oct binding protein 1; B cell specific coactivator OBF 1; B cell specific coactivator OBF1; B-cell-specific coactivator OBF-1; BOB 1; BOB-1; OBF 1; OBF1; OBF1_HUMAN; OCA B; OCA-B; OCAB; OCT binding factor 1; OCT-binding factor 1; POU class 2 associating factor 1; POU domain class 2 associating factor 1; POU domain class 2-associating factor 1; Pou2af1
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF
Expression Range	1-256aa
Protein Length	Full Length
Mol. Weight	31.4kDa
Research Area	Transcription
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Transcriptional coactivator that specifically associates with either POU2F1/OCT1 or POU2F2/OCT2. It boosts the POU2F1/OCT1 mediated promoter activity and to a lesser extent, that of POU2F2/OCT2. It has no intrinsic DNA-binding activity. It recognizes the POU domains of POU2F1/OCT1 and POU2F2/OCT2. It is essential for the response of B-cells to antigens and required for the formation of germinal centers. Regulates IL6 expression in B cells as POU2F2/OCT2 coactivator.
Subcellular Location	Nucleus.
Protein Families	POU2AF1 family
Database References	HGNC: 9211 OMIM: 601206 KEGG: hsa:5450 STRING: 9606.ENSP00000376786 UniGene: Hs.654525
Associated Diseases	A chromosomal aberration involving POU2AF1/OBF1 may be a cause of a form of B-cell leukemia. Translocation t(3;11)(q27;q23) with BCL6.
Tissue Specificity	B-cell specific. Detected in mainly in spleen, but also in thymus, periphral blood leukocyte and small intestine.

Gene Functions References

The number of follicular B2 lymphocytes and expression of the B-cell-specific transcriptional coactivator OcaB increase with age in spleen and in intra-abdominal epididymal white adipose tissue (eWAT), concomitantly with higher circulating levels of IgG and impaired glucose homeostasis. PMID: 29496744
These findings demonstrate for the first time that functional polymorphism in the 3'-UTR of POU2AF1 is associated with susceptibility, and that single-nucleotide polymorphisms interaction with hsa-miR-633 affects gene expression and increases the risk of lymphoma. PMID: 28345816
Oct2 and Bob1 are very reliable in determining B cell lineage in the absence of expression of other pan-B cell markers PMID: 27319306
these findings suggest a novel function of POU2AF1 as a potential regulator of host defense genes in the human airway epithelium. PMID: 26927796
It has been identified as a new disease susceptibility gene among Japanese. Though different from Europeans, it is indicated that a B lymphocyte differentiation route shares a common disease developing process. [Review] PMID: 24005100
Two significant susceptibility loci, TNFSF15 (rs4979462) and POU2AF1 (rs4938534) (combined odds ratio [OR] = 1.56, p = 2.84 x 10(-14) for rs4979462. PMID: 23000144
genetic polymorphism is associated with common variable immunodeficiency PMID: 21905497
Data show that Igh 3' enhancer-bound OCA-B and promoter-bound TFII-I mediate promoter-enhancer interactions, in both cis and trans, that are important for Igh transcription. PMID: 21549311
On multivariate analysis, co-expression of OCT-2/BOB.1 remained predictive for achievement of complete remission and increased risk of relapse. PMID: 20141429
BOB.1 may be helpful marker in the differential diagnosis of classical Hodgkin's lymphoma and primary mediastinal B-cell lymphoma PMID: 20102401
The expression of the octamer cofactor gene OBF-1 (Bob1/OCA-B) is sufficient to override the silencing effects of the B29 silencer, indicating that OBF-1 plays a critical role in B cell-specific B29 promoter expression. PMID: 11907094
enhances transcriptional potential of Oct1 PMID: 12727885
OCA-B sustains expression of the immunoglobulin-secreting program when T lymphoma and plasmacytoma lines are fused, requiring Oct-2 coregulator for its function. PMID: 14662861
POU2AF1 was observed to be differentially expressed in the cells of patients with chronic lymphocytic leukemia. PMID: 15672409
Alteration of the BOB1 locus does not correlate with its suppressed expression in Hodgkin lymphoma. PMID: 15796964
Novel germ cell markers BOB1 were significantly upregulated in seminoma specimens, compared to normal testes. PMID: 17785371
Oct-2 and its cofactor Bob-1 have an important function in mediating the IgH enhancer-bcl-2 promoter region interactions PMID: 18695675

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.