Recombinant Human Potassium Voltage-Gated Channel Subfamily D Member 2 (KCND2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10293P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Potassium Voltage-Gated Channel Subfamily D Member 2 (KCND2) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10293P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Potassium Voltage-Gated Channel Subfamily D Member 2 (KCND2) Protein (His) is produced by our Yeast expression system. This is a cytoplasmic protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9NZV8 |
| Target Symbol | KCND2 |
| Synonyms | KCD2; KCND 2; KCND2; KCND2_HUMAN; KIAA1044; MGC119702; MGC119703; Potassium voltage gated channel Shal related subfamily member 2; Potassium voltage-gated channel subfamily D member 2; RK 5; RK5; Voltage gated potassium channel Kv4.2; Voltage gated potassium channel subunit Kv4.2; Voltage sensitive potassium channel; Voltage-gated potassium channel subunit Kv4.2 |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | VSNFSRIYHQNQRADKRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL |
| Expression Range | 406-630aa |
| Protein Length | Cytoplasmic Domain |
| Mol. Weight | 27.0kDa |
| Research Area | Transport |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain. Mediates the major part of the dendritic A-type current I(SA) in brain neurons. This current is activated at membrane potentials that are below the threshold for action potentials. It regulates neuronal excitability, prolongs the latency before the first spike in a series of action potentials, regulates the frequency of repetitive action potential firing, shortens the duration of action potentials and regulates the back-propagation of action potentials from the neuronal cell body to the dendrites. Contributes to the regulation of the circadian rhythm of action potential firing in suprachiasmatic nucleus neurons, which regulates the circadian rhythm of locomotor activity. Functions downstream of the metabotropic glutamate receptor GRM5 and plays a role in neuronal excitability and in nociception mediated by activation of GRM5. Mediates the transient outward current I(to) in rodent heart left ventricle apex cells, but not in human heart, where this current is mediated by another family member. Forms tetrameric potassium-selective channels through which potassium ions pass in accordance with their electrochemical gradient. The channel alternates between opened and closed conformations in response to the voltage difference across the membrane. Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCND2 and KCND3; channel properties depend on the type of pore-forming alpha subunits that are part of the channel. In vivo, membranes probably contain a mixture of heteromeric potassium channel complexes. Interaction with specific isoforms of the regulatory subunits KCNIP1, KCNIP2, KCNIP3 or KCNIP4 strongly increases expression at the cell surface and thereby increases channel activity; it modulates the kinetics of channel activation and inactivation, shifts the threshold for channel activation to more negative voltage values, shifts the threshold for inactivation to less negative voltages and accelerates recovery after inactivation. Likewise, interaction with DPP6 or DPP10 promotes expression at the cell membrane and regulates both channel characteristics and activity. |
| Subcellular Location | Cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Cell junction, synapse. Perikaryon. Cell junction, synapse, postsynaptic cell membrane. Cell projection, dendritic spine. Cell junction. |
| Protein Families | Potassium channel family, D (Shal) (TC 1.A.1.2) subfamily, Kv4.2/KCND2 sub-subfamily |
| Database References | HGNC: 6238 OMIM: 605410 KEGG: hsa:3751 STRING: 9606.ENSP00000333496 UniGene: PMID: 29581270 |
![SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)](http://www.betalifesci.com/cdn/shop/files/1ihmbkjr21vdmc6j_{width}x.jpg?v=1753363793)
