Recombinant Human Potassium Voltage-Gated Channel Subfamily D Member 1 (KCND1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10297P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Potassium Voltage-Gated Channel Subfamily D Member 1 (KCND1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-10297P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Potassium Voltage-Gated Channel Subfamily D Member 1 (KCND1) Protein (His) is produced by our Yeast expression system. This is a cytoplasmic protein. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | Q9NSA2 |
| Target Symbol | KCND1 |
| Synonyms | Kcnd1; KCND1_HUMAN; Kv4.1; mShal; OTTHUMP00000025805; OTTHUMP00000025806; Potassium voltage gated channel Shal related subfamily member 1; Potassium voltage gated channel subfamily D member 1; Potassium voltage-gated channel subfamily D member 1; Shal type potassium channel; Voltage gated potassium channel Kv4.1; Voltage gated potassium channel subunit Kv4.1; Voltage-gated potassium channel subunit Kv4.1 |
| Species | Homo sapiens (Human) |
| Expression System | Yeast |
| Tag | N-6His |
| Target Protein Sequence | NFSRIYHQNQRADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHHLLHCLEKTTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRRAIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIISIPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL |
| Expression Range | 410-647aa |
| Protein Length | Cytoplasmic Domain |
| Mol. Weight | 27.7kDa |
| Research Area | Neuroscience |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits. |
| Subcellular Location | Membrane; Multi-pass membrane protein. Cell projection, dendrite. |
| Protein Families | Potassium channel family, D (Shal) (TC 1.A.1.2) subfamily, Kv4.1/KCND1 sub-subfamily |
| Database References | HGNC: 6237 OMIM: 300281 KEGG: hsa:3750 STRING: 9606.ENSP00000218176 UniGene: PMID: 24675763 |
