Recombinant Human Podocalyxin (PODXL) Protein (His)

Name: Recombinant Human Podocalyxin (PODXL) Protein (His)
Brand: Beta LifeScience
SKU: BLC-03557P
Availability: InStock

Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) PODXL.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Podocalyxin (PODXL) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	O00592
Target Symbol	PODXL
Synonyms	GCTM-2 antigen; Gp2; Gp200; MGC138240; PC; PCLP; PCLP-1; PCLP1; Pcx; Podocalyxin; Podocalyxin like; Podocalyxin like protein; Podocalyxin-like protein 1; Podxl; PODXL_HUMAN
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-6His
Target Protein Sequence	QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRF
Expression Range	32-458aa
Protein Length	Partial
Mol. Weight	48.2kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Involved in the regulation of both adhesion and cell morphology and cancer progression. Functions as an anti-adhesive molecule that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repulsion. Acts as a pro-adhesive molecule, enhancing the adherence of cells to immobilized ligands, increasing the rate of migration and cell-cell contacts in an integrin-dependent manner. Induces the formation of apical actin-dependent microvilli. Involved in the formation of a preapical plasma membrane subdomain to set up initial epithelial polarization and the apical lumen formation during renal tubulogenesis. Plays a role in cancer development and aggressiveness by inducing cell migration and invasion through its interaction with the actin-binding protein EZR. Affects EZR-dependent signaling events, leading to increased activities of the MAPK and PI3K pathways in cancer cells.
Subcellular Location	Apical cell membrane. Cell projection, lamellipodium. Cell projection, filopodium. Cell projection, ruffle. Cell projection, microvillus. Membrane raft. Membrane; Single-pass type I membrane protein.
Protein Families	Podocalyxin family
Database References	HGNC: 9171 OMIM: 602632 KEGG: hsa:5420 STRING: 9606.ENSP00000367817 UniGene: PMID: 29321582 Results show high podocalyxin expression in prostate cancer and can be used as a tumor marker for disease progression and patients stratification. PMID: 30396958 Summary of the structural features of podocalyxin glycoforms from embryonic and induced pluripotent stem cells (review). PMID: 28980094 This set of symptoms strikingly mimics previously reported mouse Podxl(-/-) embryos, emphasizing the essential function of PODXL in mammalian kidney development and highlighting this patient as a human PODXL-null model. PMID: 29244787 These results indicate that PcMab-47 is useful in detecting podocalyxin of oral cancers for immunohistochemical analysis PMID: 28873000 expression of PODXL associates with TAZ downstream gene expression. Suppression of PODXL induces phosphorylation of LATS1 and TAZ, and is accompanied with a decrease in TAZ protein expression. We speculate that changes in actin cytoskeleton may participate in PODXL-mediated TAZ signaling. PMID: 28946619 Results show that PODXL performs as a tumor promoter in gastric tumor cells (GC). PODXL is a target gene of miR-509-3-5P; the ectopic expression of miR-509-3-5P in GC cell lines inhibits the colony, motility and invasion abilities via negatively targeting PODXL. PMID: 28432273 Podocalyxin as a major pluripotent marker and novel keratan sulfate proteoglycan in human embryonic and induced pluripotent stem cells. PMID: 28078490 A novel frameshift mutation in PODXL seems to be the likely cause of ARJP in this family. PMID: 26864383 These findings suggest a potential functional link in colorectal cancer between PODXL, EGFR and BRAF. PMID: 27160084 PODXL enhances motility and invasiveness through an increase in gelsolin-actin interactions in cell protrusions. PMID: 27461278 Results identify an anti-metastatic miRNA, miR-5100, that decreases the metastatic ability of pancreatic cancer partially by suppressing expression of PODXL. PMID: 26892887 Results indicate that urinary podocalyxin is not only an early marker but also a treatment target for diabetic nephropathy (DN). PMID: 26635084 Obese subjects showed evidence of renal alteration through the detection of a higher number of urinary podocalyxin positive cells. PMID: 25905599 Data show that both mucin16 (MUC16) and podocalyxin (PODXL)-E-selectin-mediated interactions are mechanically stronger than like L-selectin interactions at the single-molecule level. PMID: 26329844 In gastric cancer, PODXL expression by the polyclonal antibody HPA2110 is an independent marker of poor prognosis. PMID: 26674770 PCX promotes cisplatin chemoresistance in osteosarcoma cells through a PI3Kdependent mechanism. PMID: 26017117 EZR, CLIC5 and PODXL are overexpressed in hepatocellular carcinoma and may have a role in cell migration and invasiveness PMID: 26135398 PODXL up-regulates the expression level of Bmi1 in OTSCC cells. PMID: 25915207 podocalyxin to be an independent factor for poor prognosis in PDAC. To our knowledge, this is the first such report of its prognostic value. PMID: 26053486 miR-125b was found to be important in arteriosclerosis obliterans by suppressing the expression of PODXL and may serve as a potential therapeutic target for the treatment of arteriosclerosis obliterans. PMID: 25738314 We show that podocalyxin plays a key role in the formation of primary tumors and distant tumor metastasis. PMID: 25887862 PCLP1 expressed on breast tumor cells may function as an immunomodulatory molecule, which may represent a mechanism to evade the immune response. PMID: 26276714 These findings show that overexpression of PODXL enhanced invadopodia formation and tumor metastasis by inducing Rac1/Cdc42/cortactin signaling network. PMID: 24970760 overexpression of PODXL may be associated with human oral squamous cell carcinoma aggressiveness PMID: 24821609 A variant form of PODXL remains the most likely candidate causing focal and segmental glomerulosclerosis in a family with autosomal dominant inheritance. PMID: 24048372 Suggest that analysis of PODXL expression in the primary tumour is sufficient for its use as a prognostic and treatment predictive biomarker in colorectal cancer, also in patients with metastatic disease. PMID: 23819542 Urinary Podocalyxin positive-element may be a noninvasive marker for the early stage of Diabetic nephropathy. PMID: 24075693 TRA-1-81 is expressed only in the cytoplasm of uterine smooth muscle neoplasms. PMID: 24143384 PODXL is expressed in glioblastoma multiforme stem-like cells and is involved in cell proliferation and oncosphere formation. PMID: 24146797 Membranous PODXL expression is an independent risk factor for progressive disease and death in patients with urothelial bladder cancer PMID: 23652315 The results obtained indicate that integrity of the PODXL ectodomain is essential for enhancing cell adhesion but not migration, while the integrity of the cytoplasmic domain is required for both adhesion and migration. PMID: 23396057 PODXL protein expression was analyzed n tissue microarrays with colorectal cancer tumor samples. High PODXL protein expression was significantly associated with unfavourable clinicopathological characteristics in both cohorts. PMID: 22769594 PODXL has the potential to be a useful biomarker for identifying good prognosis patients in characteristically poor prognosis breast cancer groups and may impact treatment of women with this disease. PMID: 23288345 podocalyxin, a heavily glycosylated type 1 transmembrane protein, is a glycoprotein ligand of recombinant N-terminal domain of the lectin BC2L-C from Burkholderia cenocepacia on human induced pluripotent stem cells and embryonic stem cells. PMID: 23526252 Levels of urinary PCX and the number of urinary podocytes are associated with histologic abnormalities in adults with IgA nephropathy. PMID: 22700887 Sialofucosylated PODXL is a functional E-and L-selectin ligand expressed by metastatic pancreatic cancer cells. PMID: 22814396 Most AML patients had a significant decrease in miR-199b-5p levels with elevated PODXL & DDR1 expressions. Both PODXL & DDR1 are targets of miR-199b-5p. PMID: 22374871 podocalyxin's ability to facilitate the formation of non-adhesive membrane domains may contribute to the formation of free-floating high grade serous tumor nodules during the initial steps of transperitoneal metastasis. PMID: 22262060 Podocalyxin-like 1 expression is an independent factor of poor prognosis in colorectal carcinoma. PMID: 21829192 The urinary mRNA profiles of synaptopodin, podocalyxin, CD2-AP, alpha-actin4, and podocin were found to increase with the progression of diabetic nephropathy. PMID: 21655212 This report identifies DNA methylation, miR-199a dysregulation and PODXL as critical factors in tumor malignancy. PMID: 21383689 PINCH1 is transcriptional regulator in podocytes that interacts with WT1 and represses podocalyxin expression. PMID: 21390327 intact PODXL is released to the extracellular space as a cargo of microvesicles and also as a soluble cleaved fragment of ectodomain PMID: 21616097 Data show that podocalyxin overexpression in human embryonic kidney cells up-regulates Rac1 activity, which depends on a complex formed by podocalyxin, ERM-binding phosphoprotein 50, ezrin, and ARHGEF7, a Rac1 activator. PMID: 20395446 In pluripotent stem cells and in human cancer disease, podocalyxin may function in part to regulate and maintain the cell surface expression of the glucose-3-transporter. PMID: 20599725 podocalyxin has a role in defining the structure of the podocyte basal surface PMID: 15226400 Overexpression of the anti-adhesin podocalyxin is associated with breast cancer progression PMID: 15289306 PODXL variants are implicated in prostate neoplasm aggressiveness, with gene mapping to chromosome 7q32-q33. PMID: 16434482 Transcriptional regulation of Podxl is supported primarily by Sp1 site(s) and that DNA-methylation of the CpG promoter islands contributes to control the tissue specific expression of podxl. PMID: 16684343

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.