Recombinant Human Podocalyxin (PODXL) Protein (His)

Beta LifeScience SKU/CAT #: BLC-03228P
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SDS-PAGE.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PODXL.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PODXL.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PODXL.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of this product could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PODXL.

Recombinant Human Podocalyxin (PODXL) Protein (His)

Beta LifeScience SKU/CAT #: BLC-03228P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Podocalyxin (PODXL) Protein (His) is produced by our Yeast expression system. This is a protein fragment.
Purity Greater than 90% as determined by SDS-PAGE.
Uniprotkb O00592
Target Symbol PODXL
Synonyms GCTM-2 antigen; Gp2; Gp200; MGC138240; PC; PCLP; PCLP-1; PCLP1; Pcx; Podocalyxin; Podocalyxin like; Podocalyxin like protein; Podocalyxin-like protein 1; Podxl; PODXL_HUMAN
Species Homo sapiens (Human)
Expression System Yeast
Tag N-6His
Target Protein Sequence QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRF
Expression Range 32-458aa
Protein Length Partial
Mol. Weight 46.2kDa
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Involved in the regulation of both adhesion and cell morphology and cancer progression. Functions as an anti-adhesive molecule that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repulsion. Acts as a pro-adhesive molecule, enhancing the adherence of cells to immobilized ligands, increasing the rate of migration and cell-cell contacts in an integrin-dependent manner. Induces the formation of apical actin-dependent microvilli. Involved in the formation of a preapical plasma membrane subdomain to set up initial epithelial polarization and the apical lumen formation during renal tubulogenesis. Plays a role in cancer development and aggressiveness by inducing cell migration and invasion through its interaction with the actin-binding protein EZR. Affects EZR-dependent signaling events, leading to increased activities of the MAPK and PI3K pathways in cancer cells.
Subcellular Location Apical cell membrane. Cell projection, lamellipodium. Cell projection, filopodium. Cell projection, ruffle. Cell projection, microvillus. Membrane raft. Membrane; Single-pass type I membrane protein.
Protein Families Podocalyxin family
Database References

HGNC: 9171

OMIM: 602632

KEGG: hsa:5420

STRING: 9606.ENSP00000367817

UniGene: PMID: 29321582

  • Results show high podocalyxin expression in prostate cancer and can be used as a tumor marker for disease progression and patients stratification. PMID: 30396958
  • Summary of the structural features of podocalyxin glycoforms from embryonic and induced pluripotent stem cells (review). PMID: 28980094
  • This set of symptoms strikingly mimics previously reported mouse Podxl(-/-) embryos, emphasizing the essential function of PODXL in mammalian kidney development and highlighting this patient as a human PODXL-null model. PMID: 29244787
  • These results indicate that PcMab-47 is useful in detecting podocalyxin of oral cancers for immunohistochemical analysis PMID: 28873000
  • expression of PODXL associates with TAZ downstream gene expression. Suppression of PODXL induces phosphorylation of LATS1 and TAZ, and is accompanied with a decrease in TAZ protein expression. We speculate that changes in actin cytoskeleton may participate in PODXL-mediated TAZ signaling. PMID: 28946619
  • Results show that PODXL performs as a tumor promoter in gastric tumor cells (GC). PODXL is a target gene of miR-509-3-5P; the ectopic expression of miR-509-3-5P in GC cell lines inhibits the colony, motility and invasion abilities via negatively targeting PODXL. PMID: 28432273
  • Podocalyxin as a major pluripotent marker and novel keratan sulfate proteoglycan in human embryonic and induced pluripotent stem cells. PMID: 28078490
  • A novel frameshift mutation in PODXL seems to be the likely cause of ARJP in this family. PMID: 26864383
  • These findings suggest a potential functional link in colorectal cancer between PODXL, EGFR and BRAF. PMID: 27160084
  • PODXL enhances motility and invasiveness through an increase in gelsolin-actin interactions in cell protrusions. PMID: 27461278
  • Results identify an anti-metastatic miRNA, miR-5100, that decreases the metastatic ability of pancreatic cancer partially by suppressing expression of PODXL. PMID: 26892887
  • Results indicate that urinary podocalyxin is not only an early marker but also a treatment target for diabetic nephropathy (DN). PMID: 26635084
  • Obese subjects showed evidence of renal alteration through the detection of a higher number of urinary podocalyxin positive cells. PMID: 25905599
  • Data show that both mucin16 (MUC16) and podocalyxin (PODXL)-E-selectin-mediated interactions are mechanically stronger than like L-selectin interactions at the single-molecule level. PMID: 26329844
  • In gastric cancer, PODXL expression by the polyclonal antibody HPA2110 is an independent marker of poor prognosis. PMID: 26674770
  • PCX promotes cisplatin chemoresistance in osteosarcoma cells through a PI3Kdependent mechanism. PMID: 26017117
  • EZR, CLIC5 and PODXL are overexpressed in hepatocellular carcinoma and may have a role in cell migration and invasiveness PMID: 26135398
  • PODXL up-regulates the expression level of Bmi1 in OTSCC cells. PMID: 25915207
  • podocalyxin to be an independent factor for poor prognosis in PDAC. To our knowledge, this is the first such report of its prognostic value. PMID: 26053486
  • miR-125b was found to be important in arteriosclerosis obliterans by suppressing the expression of PODXL and may serve as a potential therapeutic target for the treatment of arteriosclerosis obliterans. PMID: 25738314
  • We show that podocalyxin plays a key role in the formation of primary tumors and distant tumor metastasis. PMID: 25887862
  • PCLP1 expressed on breast tumor cells may function as an immunomodulatory molecule, which may represent a mechanism to evade the immune response. PMID: 26276714
  • These findings show that overexpression of PODXL enhanced invadopodia formation and tumor metastasis by inducing Rac1/Cdc42/cortactin signaling network. PMID: 24970760
  • overexpression of PODXL may be associated with human oral squamous cell carcinoma aggressiveness PMID: 24821609
  • A variant form of PODXL remains the most likely candidate causing focal and segmental glomerulosclerosis in a family with autosomal dominant inheritance. PMID: 24048372
  • Suggest that analysis of PODXL expression in the primary tumour is sufficient for its use as a prognostic and treatment predictive biomarker in colorectal cancer, also in patients with metastatic disease. PMID: 23819542
  • Urinary Podocalyxin positive-element may be a noninvasive marker for the early stage of Diabetic nephropathy. PMID: 24075693
  • TRA-1-81 is expressed only in the cytoplasm of uterine smooth muscle neoplasms. PMID: 24143384
  • PODXL is expressed in glioblastoma multiforme stem-like cells and is involved in cell proliferation and oncosphere formation. PMID: 24146797
  • Membranous PODXL expression is an independent risk factor for progressive disease and death in patients with urothelial bladder cancer PMID: 23652315
  • The results obtained indicate that integrity of the PODXL ectodomain is essential for enhancing cell adhesion but not migration, while the integrity of the cytoplasmic domain is required for both adhesion and migration. PMID: 23396057
  • PODXL protein expression was analyzed n tissue microarrays with colorectal cancer tumor samples. High PODXL protein expression was significantly associated with unfavourable clinicopathological characteristics in both cohorts. PMID: 22769594
  • PODXL has the potential to be a useful biomarker for identifying good prognosis patients in characteristically poor prognosis breast cancer groups and may impact treatment of women with this disease. PMID: 23288345
  • podocalyxin, a heavily glycosylated type 1 transmembrane protein, is a glycoprotein ligand of recombinant N-terminal domain of the lectin BC2L-C from Burkholderia cenocepacia on human induced pluripotent stem cells and embryonic stem cells. PMID: 23526252
  • Levels of urinary PCX and the number of urinary podocytes are associated with histologic abnormalities in adults with IgA nephropathy. PMID: 22700887
  • Sialofucosylated PODXL is a functional E-and L-selectin ligand expressed by metastatic pancreatic cancer cells. PMID: 22814396
  • Most AML patients had a significant decrease in miR-199b-5p levels with elevated PODXL & DDR1 expressions. Both PODXL & DDR1 are targets of miR-199b-5p. PMID: 22374871
  • podocalyxin's ability to facilitate the formation of non-adhesive membrane domains may contribute to the formation of free-floating high grade serous tumor nodules during the initial steps of transperitoneal metastasis. PMID: 22262060
  • Podocalyxin-like 1 expression is an independent factor of poor prognosis in colorectal carcinoma. PMID: 21829192
  • The urinary mRNA profiles of synaptopodin, podocalyxin, CD2-AP, alpha-actin4, and podocin were found to increase with the progression of diabetic nephropathy. PMID: 21655212
  • This report identifies DNA methylation, miR-199a dysregulation and PODXL as critical factors in tumor malignancy. PMID: 21383689
  • PINCH1 is transcriptional regulator in podocytes that interacts with WT1 and represses podocalyxin expression. PMID: 21390327
  • intact PODXL is released to the extracellular space as a cargo of microvesicles and also as a soluble cleaved fragment of ectodomain PMID: 21616097
  • Data show that podocalyxin overexpression in human embryonic kidney cells up-regulates Rac1 activity, which depends on a complex formed by podocalyxin, ERM-binding phosphoprotein 50, ezrin, and ARHGEF7, a Rac1 activator. PMID: 20395446
  • In pluripotent stem cells and in human cancer disease, podocalyxin may function in part to regulate and maintain the cell surface expression of the glucose-3-transporter. PMID: 20599725
  • podocalyxin has a role in defining the structure of the podocyte basal surface PMID: 15226400
  • Overexpression of the anti-adhesin podocalyxin is associated with breast cancer progression PMID: 15289306
  • PODXL variants are implicated in prostate neoplasm aggressiveness, with gene mapping to chromosome 7q32-q33. PMID: 16434482
  • Transcriptional regulation of Podxl is supported primarily by Sp1 site(s) and that DNA-methylation of the CpG promoter islands contributes to control the tissue specific expression of podxl. PMID: 16684343
  • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    Recently viewed