Recombinant Human Platelet-Derived Growth Factor Subunit A (PDGFA) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-06001P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Platelet-Derived Growth Factor Subunit A (PDGFA) Protein (His), Active
Beta LifeScience
SKU/CAT #: BLC-06001P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Platelet-Derived Growth Factor Subunit A (PDGFA) Protein (His), Active is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
Activity | The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 300 ng/ml. |
Uniprotkb | P04085 |
Target Symbol | PDGFA |
Synonyms | PDGF A; PDGF A chain; PDGF subunit A; PDGF-1; PDGF1; PDGFA; PDGFA_HUMAN; Platelet derived growth factor alpha chain; Platelet derived growth factor alpha isoform 2 preproprotein; Platelet derived growth factor alpha polypeptide ; Platelet-derived growth factor A chain; Platelet-derived growth factor alpha polypeptide; Platelet-derived growth factor subunit A |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Complete Sequence | SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT |
Expression Range | 87-211aa |
Protein Length | Full Length of Mature Protein |
Mol. Weight | 15.9 kDa |
Research Area | Cancer |
Form | Lyophilized powder |
Buffer | Lyophilized from a 0.2 μm filtered solution of 4mM HCL |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal lung alveolar septum formation during embryogenesis, normal development of the gastrointestinal tract, normal development of Leydig cells and spermatogenesis. Required for normal oligodendrocyte development and normal myelination in the spinal cord and cerebellum. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFB. |
Subcellular Location | Secreted. Note=Released by platelets upon wounding. |
Protein Families | PDGF/VEGF growth factor family |
Database References | HGNC: 8799 OMIM: 173430 KEGG: hsa:5154 STRING: 9606.ENSP00000346508 UniGene: PMID: 30340644 |