Recombinant Human Platelet-derived Growth Factor-BB (PDGFB), Active, GMP
Beta LifeScience
SKU/CAT #: BLC-05994P
Greater than 98% as determined by SDS-PAGE.
Recombinant Human Platelet-derived Growth Factor-BB (PDGFB), Active, GMP
Beta LifeScience
SKU/CAT #: BLC-05994P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Platelet-derived Growth Factor-BB (PDGFB), Active, GMP is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 98% as determined by SDS-PAGE and HPLC. |
| Endotoxin | Less than 0.01 EU/μg of rHuPDGF-BB GMP as determined by LAL method. |
| Activity | Measured in a cell proliferation assay using BALB/c 3T3 cells.The ED50 for this effect is 15-60ng/ml. |
| Uniprotkb | P01127 |
| Target Symbol | PDGFB |
| Synonyms | Becaplermin; c sis; FLJ12858; Oncogene SIS; PDGF 2; PDGF B chain; PDGF Beta; PDGF subunit B; PDGF-2; PDGF2; Pdgfb; PDGFB_HUMAN; Platelet derived growth factor 2; Platelet derived growth factor B chain; Platelet derived growth factor beta; Platelet derived growth factor beta polypeptide (oncogene SIS); Platelet derived growth factor beta polypeptide (simian sarcoma viral (v sis) oncogene homolog); Platelet derived growth factor beta polypeptide; Platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide; Platelet-derived growth factor subunit B; Proto-oncogene c-Sis; Simian sarcoma viral (v sis) oncogene homolog; SIS; SSV; v sis platelet derived growth factor beta polypeptide |
| Species | Homo sapiens (Human) |
| Expression System | E.Coli |
| Tag | Tag-Free |
| Complete Sequence | M+SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPV |
| Expression Range | 82-190aa |
| Protein Length | Partial |
| Mol. Weight | 12.4kDa |
| Research Area | Cancer |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered solution of 20mM NaAc-HAc, pH 4.5. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA. |
| Subcellular Location | Secreted. Note=Released by platelets upon wounding. |
| Protein Families | PDGF/VEGF growth factor family |
| Database References | HGNC: 8800 OMIM: 190040 KEGG: hsa:5155 STRING: 9606.ENSP00000330382 UniGene: PMID: 29168174 |
