Recombinant Human Platelet Basic Protein (PPBP) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08353P
Greater than 90% as determined by SDS-PAGE.
Recombinant Human Platelet Basic Protein (PPBP) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-08353P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
| Description | Recombinant Human Platelet Basic Protein (PPBP) Protein (GST) is produced by our E.coli expression system. This is a protein fragment. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Uniprotkb | P02775 |
| Target Symbol | PPBP |
| Synonyms | B TG1; Beta TG ; Beta thromboglobulin; Beta-TG; C-X-C motif chemokine 7; Chemokine (C X C motif) ligand 7; Connective tissue activating peptide III; CTAP 3; CTAP III; CTAP-III; CTAP-III(1-81); CTAP3; CTAPIII; CXC chemokine ligand 7; CXCL 7; CXCL7; CXCL7_HUMAN; LA PF 4; LA-PF4; LDGF; Leukocyte derived growth factor; Leukocyte-derived growth factor; Low-affinity platelet factor IV; Macrophage-derived growth factor; MDGF; NAP 2; NAP-2; NAP-2(1-63); NAP-2(1-66); NAP-2(73); NAP-2(74); Neutrophil activating peptide 2; Neutrophil-activating peptide 2(1-63); PBP; Platelet basic protein; PPBP; Pro platelet basic protein (chemokine (C-X-C motif) ligand 7); Pro platelet basic protein; SCYB7; Small inducible cytokine subfamily B member 7; Small-inducible cytokine B7; TC1; TC2; TGB; TGB1; THBGB; THBGB1; Thrombocidin 1; Thrombocidin 2; Thromboglobulin; beta-1 |
| Species | Homo sapiens (Human) |
| Expression System | E.coli |
| Tag | N-GST |
| Target Protein Sequence | AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDE |
| Expression Range | 59-125aa |
| Protein Length | Partial |
| Mol. Weight | 34.4kDa |
| Research Area | Immunology |
| Form | Liquid or Lyophilized powder |
| Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
| Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
| Target Function | LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation. |
| Subcellular Location | Secreted. |
| Protein Families | Intercrine alpha (chemokine CxC) family |
| Database References | HGNC: 9240 OMIM: 121010 KEGG: hsa:5473 STRING: 9606.ENSP00000296028 UniGene: PMID: 29782494 |
