Recombinant Human Placenta-Expressed Transcript 1 Protein (PLET1) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-04985P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Placenta-Expressed Transcript 1 Protein (PLET1) Protein (His&Myc)

Beta LifeScience SKU/CAT #: BLC-04985P
Save $1,105
/
Size

Product Overview

Description Recombinant Human Placenta-Expressed Transcript 1 Protein (PLET1) Protein (His&Myc) is produced by our Baculovirus expression system. This is a full length protein.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb Q6UQ28
Target Symbol PLET1
Synonyms C11orf34; Chromosome 11 open reading frame 34; OTTHUMP00000235436; Placenta expressed transcript 1; Placenta-expressed transcript 1 protein; PLET1; PLET1_HUMAN
Species Homo sapiens (Human)
Expression System Baculovirus
Tag N-10His&C-Myc
Target Protein Sequence TFIRYSSTCFTFDEYYTITLDIKASSHIYESNAVYSVFVPVNDSVYAVVMKTLDENSDSAGLWQRADKNCYSNSTYYVKDQYMTVLEAQWQAPEPENITEVEIQAFTVQIRALPILSTLKLREKLSTLALAAKIPQSSAFKPFFMITPKSIRLEGLANQVFS
Expression Range 26-187aa
Protein Length Full Length of Mature Protein
Mol. Weight 22.3
Research Area Cell Biology
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Modulates leading keratinocyte migration and cellular adhesion to matrix proteins during a wound-healing response and promotes wound repair. May play a role during trichilemmal differentiation of the hair follicle.
Subcellular Location Apical cell membrane; Lipid-anchor, GPI-anchor.
Database References

Gene Functions References

  1. Plet-1 will thus provide an invaluable tool for genetic analysis of the lineage relationships and molecular mechanisms operating in the development, homeostasis, and injury in several organ/tissue systems PMID: 18195351

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

More from Beta LifeScience's Promotion
Western Blot | Positive WB detected in: MCF-7 whole cell lysate, A549 whole cell lysate, Mouse thymus | All lanes: ACAA2 antibody at 1:2000 | Secondary | Goat polyclonal to rabbit IgG at 1/50000 dilution | Predicted band size: 42 kDa | Observed band size: 42 kDa
IHC image of ACAA2 Recombinant Monoclonal Antibody diluted at 1:100 and staining in paraffin-embedded human colon cancer performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a Goat anti-rabbit polymer IgG labeled by HRP and visualized using 0.05% DAB.
ACAA2 Recombinant Monoclonal Antibody
CAT#: BLC-06609A
IHC image of the antibody diluted at 1:100 and staining in paraffin-embedded human breast cancer performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a Goat anti-rabbit polymer IgG labeled by HRP and visualized using 0.07% DAB.
IHC image of Acetyl-HIST1H3A(K18) Recombinant Monoclonal Antibody diluted at 1:100 and staining in paraffin-embedded human gastric cancer performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a Goat anti-rabbit polymer IgG labeled by HRP and visualized using 0.07% DAB.
Acetyl-HIST1H3A(K18) Recombinant Monoclonal Antibody
CAT#: BLC-06595A
Western BlotPositive WB detected in:293 whole cell lysate, HepG2 whole cell lysate, Mouse kidney tissueAll lanes:Acetyl-Histone H4 (K16) antibody at 1.65μg/mlSecondaryGoat polyclonal to rabbit IgG at 1/50000 dilutionPredicted band size: 11 KDaObserved band size: 11 KDa
Immunocytochemistry analysis of Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody diluted at 1:100 and staining in Hela cells performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4℃ overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody
CAT#: BLC-06518A
Western BlotPositive WB detected in:293 whole cell lysate, HepG2 whole cell lysate, Mouse kidney tissueAll lanes:Acetyl-Histone H4 (K16) antibody at 1.65μg/mlSecondaryGoat polyclonal to rabbit IgG at 1/50000 dilutionPredicted band size: 11 KDaObserved band size: 11 KDa
Immunocytochemistry analysis of Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody diluted at 1:100 and staining in Hela cells performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4℃ overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody
CAT#: BLC-06519A
Western BlotPositive WB detected in:293 whole cell lysate, HepG2 whole cell lysate, Mouse kidney tissueAll lanes:Acetyl-Histone H4 (K16) antibody at 1.65μg/mlSecondaryGoat polyclonal to rabbit IgG at 1/50000 dilutionPredicted band size: 11 KDaObserved band size: 11 KDa
Immunocytochemistry analysis of Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody diluted at 1:100 and staining in Hela cells performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4℃ overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Acetyl-Histone H4 (K16) Recombinant Monoclonal Antibody
CAT#: BLC-06520A
Western Blot | Positive WB detected in Hela whole cell lysate, MCF-7 whole cell lysate, 293 whole cell lysate, HepG2 whole cell lysate | All lanes Acetyl-Histone H4 (K5) antibody at 1.05μg/ml | Secondary | Goat polyclonal to rabbit IgG at 1/50000 dilution | Predicted band size: 11 KDa | Observed band size: 11 KDa
Immunocytochemistry analysis of Acetyl-Histone H4 (K5) Recombinant Monoclonal Antibody diluted at 1:100 and staining in Hela cells performed on a Leica BondTM system. After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4℃ overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.
Acetyl-Histone H4 (K5) Recombinant Monoclonal Antibody
CAT#: BLC-06516A
Recently viewed