Recombinant Human Placenta-Expressed Transcript 1 Protein (PLET1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-05004P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Placenta-Expressed Transcript 1 Protein (PLET1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-05004P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Placenta-Expressed Transcript 1 Protein (PLET1) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q6UQ28 |
Target Symbol | PLET1 |
Synonyms | C11orf34; Chromosome 11 open reading frame 34; OTTHUMP00000235436; Placenta expressed transcript 1; Placenta-expressed transcript 1 protein; PLET1; PLET1_HUMAN |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | TFIRYSSTCFTFDEYYTITLDIKASSHIYESNAVYSVFVPVNDSVYAVVMKTLDENSDSAGLWQRADKNCYSNSTYYVKDQYMTVLEAQWQAPEPENITEVEIQAFTVQIRALPILSTLKLREKLSTLALAAKIPQSSAFKPFFMITPKSIRLEGLANQVFS |
Expression Range | 26-187aa |
Protein Length | Full length of the mature protein |
Mol. Weight | 24.4 kDa |
Research Area | Cell Biology |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Modulates leading keratinocyte migration and cellular adhesion to matrix proteins during a wound-healing response and promotes wound repair. May play a role during trichilemmal differentiation of the hair follicle. |
Subcellular Location | Apical cell membrane; Lipid-anchor, GPI-anchor. |
Database References |