Recombinant Human Phosphoserine Phosphatase (PSPH) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09101P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Phosphoserine Phosphatase (PSPH) Protein (GST)
Beta LifeScience
SKU/CAT #: BLC-09101P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Phosphoserine Phosphatase (PSPH) Protein (GST) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P78330 |
Target Symbol | PSPH |
Synonyms | EC 3.1.3.3; L 3 phosphoserine phosphatase; L-3-phosphoserine phosphatase; O phosphoserine phosphohydrolase; O-phosphoserine phosphohydrolase; Phosphoserine phosphatase; Phosphoserine phosphatase deficiency; included; PSP; PSPase; Psph; PSPHD; SERB_HUMAN |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-GST |
Target Protein Sequence | MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE |
Expression Range | 1-225aa |
Protein Length | Full Length |
Mol. Weight | 52.0kDa |
Research Area | Signal Transduction |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Catalyzes the last irreversible step in the biosynthesis of L-serine from carbohydrates, the dephosphorylation of O-phospho-L-serine to L-serine. L-serine can then be used in protein synthesis, to produce other amino acids, in nucleotide metabolism or in glutathione synthesis, or can be racemized to D-serine, a neuromodulator. May also act on O-phospho-D-serine (Probable). |
Subcellular Location | Cytoplasm, cytosol. |
Protein Families | HAD-like hydrolase superfamily, SerB family |
Database References | HGNC: 9577 OMIM: 172480 KEGG: hsa:5723 STRING: 9606.ENSP00000275605 UniGene: PMID: 28476802 |