Recombinant Human Phospholipid Hydroperoxide Glutathione Peroxidase (GPX4) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01453P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Phospholipid Hydroperoxide Glutathione Peroxidase (GPX4) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-01453P
Collections: High-quality recombinant proteins, Other recombinant proteins
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Phospholipid Hydroperoxide Glutathione Peroxidase (GPX4) Protein (His) is produced by our Yeast expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | P36969 |
Target Symbol | GPX4 |
Synonyms | PHGPx;Glutathione peroxidase 4;GPx-4;GSHPx-4 |
Species | Homo sapiens (Human) |
Expression System | Yeast |
Tag | C-10His |
Target Protein Sequence | CASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQSGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF |
Expression Range | 29-197aa(U73S) |
Protein Length | Partial |
Mol. Weight | 21.4 kDa |
Research Area | Cancer |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Essential antioxidant peroxidase that directly reduces phospholipid hydroperoxide even if they are incorporated in membranes and lipoproteins. Can also reduce fatty acid hydroperoxide, cholesterol hydroperoxide and thymine hydroperoxide. Plays a key role in protecting cells from oxidative damage by preventing membrane lipid peroxidation. Required to prevent cells from ferroptosis, a non-apoptotic cell death resulting from an iron-dependent accumulation of lipid reactive oxygen species. The presence of selenocysteine (Sec) versus Cys at the active site is essential for life: it provides resistance to overoxidation and prevents cells against ferroptosis. The presence of Sec at the active site is also essential for the survival of a specific type of parvalbumin-positive interneurons, thereby preventing against fatal epileptic seizures. May be required to protect cells from the toxicity of ingested lipid hydroperoxides. Required for normal sperm development and male fertility. Essential for maturation and survival of photoreceptor cells. Plays a role in a primary T-cell response to viral and parasitic infection by protecting T-cells from ferroptosis and by supporting T-cell expansion. Plays a role of glutathione peroxidase in platelets in the arachidonic acid metabolism. Reduces hydroperoxy ester lipids formed by a 15-lipoxygenase that may play a role as down-regulator of the cellular 15-lipoxygenase pathway. |
Subcellular Location | [Isoform Mitochondrial]: Mitochondrion.; [Isoform Cytoplasmic]: Cytoplasm. |
Protein Families | Glutathione peroxidase family |
Database References | |
Associated Diseases | Spondylometaphyseal dysplasia, Sedaghatian type (SMDS) |
Tissue Specificity | Present primarily in testis. Expressed in platelets (at protein level). |
Gene Functions References
- Crystal structure and functional characterization of selenocysteine-containing GPX4 suggests an alternative mechanism of peroxide reduction. PMID: 29883798
- Results suggest that single nucleotide polymorphism rs713041 in glutathione peroxidase 4 (GPx4) may play a key role in the pathogenesis of preeclampsia (PE). PMID: 27641822
- Targeting Dependency on the GPX4 Lipid Peroxide Repair Pathway for Cancer Therapy. PMID: 29584411
- The results indicate that the single-nucleotide polymorphism rs713041 in GPX4 gene could modulate the pattern of global gene expression. Supplementation with Brazil nuts can modify the gene expression of some selenoproteins depending upon the presence of genetic polymorphisms. PMID: 28696394
- The proliferation of GPx4 siRNA-treated cells was downregulated compared with that of control siRNA-treated cells. GPx4 knockdown enhanced hydrogen peroxide- and ferrous sulfate-induced cytotoxicity. PMID: 27420751
- High GPX4 expression is associated with oral squamous cell carcinoma. PMID: 28653098
- By screening peptide libraries displayed on T7 phages, and analyzing the X-ray crystal structures of the peptides, we successfully identified one peptide that binds to near Sec73 of catalytic site and two peptides that bind to another site on GPX4. To our knowledge, this is the first study reporting GPX4 inhibitory peptides and their structural information. PMID: 27836545
- use GPX4 and GPX7 as possible markers for improving HCC diagnosis/prognosis. PMID: 26708178
- One SNP (rs3746162) in GPX4 was significantly associated with bladder cancer recurrence after transurethral resection. PMID: 25851338
- Hepatitis C virus (HCV) induces oxidative stress but controls it tightly by inducing ROS scavengers. Among these, GPx4 plays an essential role in the HCV life cycle. PMID: 25516417
- polymorphism of gene of glutathione peroxidase predisposes to more severe affection of liver and progression of chronic hepatitis C. PMID: 25884073
- GPx4 is essential for maintaining oxidative homeostasis and keeping defense against oxidative stress in conjunctival epithelial cells. PMID: 25574043
- Identification of truncating mutations in GPX4 in two families affected with Sedaghatian-type spondylometaphyseal dysplasia. PMID: 24706940
- GPX4c718t SNP is functional and that variants of this SNP can have detrimental consequences on endothelial function leading to a greater risk of vascular disease. PMID: 23934705
- A membrane glycoprotein GPX4 was shown to play a significant role in gamete interactions. PMID: 24191733
- Erythrocyte glutathione peroxidase activity is modified by single nucleotide polymorphisms in SEPP1, GPX4 and GPX1 and by estrogens. PMID: 24039907
- neither CYBB nor GPX4 are major genetic determinants of diabetic nephropathy, but nevertheless, they could modulate in a gender-specific manner the risk for renal disease in patients with type 1 diabetes. PMID: 23919599
- Glutathione peroxidase is a moonlighting protein that functions both as a peroxidase as well as a structural protein in mature spermatozoa. PMID: 11898409
- GPx4, through effects on AIF, plays a major role in maintaining the oxidative phosphorylation system and protecting mitochondria from oxidative damage. PMID: 22634395
- It was shown for the first time that the C718T polymorphism in the 3'-untranslated region of the GPX4 gene could be considered as a genetic marker of susceptibility to cerebral stroke in patients with essential hypertension. PMID: 22158110
- genetic association studies in a Han Chinese population in Shaanxi province: Data indicate that 2 SNP in GPx4 (rs713041, rs4807542) and down-regulation of expression of GPx4 mRNA may be related to development of Kashin-Beck disease. PMID: 21733339
- The SNPs of 5'-UTR region of the GPx4 gene might not be associated with oligo- or asthenozoospermic male infertility PMID: 21644221
- the T/C variant GPX4 (rs713041) alters the pattern of selenoprotein synthesis if selenium intake is low PMID: 21459128
- a direct role of nuclear GPx4 in the (selenium-dependent) prevention of oxidative damage in the gastrointestinal tract. PMID: 21252226
- an examination of gene expression PMID: 12152199
- sperm content of phospholipid hydroperoxide glutathione peroxidase is correlated with fertility-related parameters and can be considered a predictive measure for fertilization capacity in humans PMID: 12193409
- tissue distribution of alternatively spliced snGPx PMID: 12427732
- data from screening of the region of the GPX4 gene corresponding to the 3'UTR show a T/C variant at position 718 that affects the levels of lymphocyte 5-lipoxygenase total products PMID: 12490284
- Gpx-4 polymorphism cannot generally account for the correlation of phospholipid hydroperoxide glutathione peroxidase content of sperm and fertility-related parameters. Further examination of this gene as a potential cause of infertility is warranted. PMID: 12606444
- PhGPx can lower the peroxide tone, which might change the cellular redox environment resulting in a delay in G1 transit PMID: 12868489
- GPX4 up-regulates arachidonate metabolism in a epidermoid carcinoma tumor cell line. PMID: 12958179
- lipids, cytokines and antioxidants modulate GPx4 in a complex manner that in the presence of adequate selenium, may favour protection against potentially proatherogenic processes. PMID: 14642406
- No statistically significant differences for glutathione peroxidase, phospholipid hydroperoxide glutathione peroxidase, and glutathione reductase were encountered between normal values and those of asthenozoospermic patients. PMID: 15149466
- Sperm nucleus PHGPx expression is mediated by the transcription factor CREM-tau, which acts as a cis-acting element localized in the first intron of the PHGPx gene. PMID: 15225122
- This review addresses the role of mitochondrial phospholipid hydroperoxide glutathione peroxidase in the regulation of apoptosis. PMID: 15256721
- PHGPx modulates the induction of MMP-1 and collagenase. PMID: 15308634
- Intracellular sperm GSH system components GPX-4 and GSH are altered in infertile men, and these alterations seem to be linked to sperm morphology. PMID: 15474074
- Increased activities of erythrocyte glutathione peroxidase is associated with cerebral palsy PMID: 15978628
- Oligoasthenozoospermia is associated with a decrease in the level of expression of PHGPx in the spermatozoa of some infertile men but is not linked to mutations in PHGPx gene. PMID: 16872467
- we investigated both GPx-4 activity and localization in subcellular fractions of human platelets. Confocal immunofluorescence microscopy localized mainly GPx-4 to membranes of activated platelets in contrast to cytoplasm in the resting cells. PMID: 17020817
- Role for selenium in risk of lung cancer and independent regulation of GPX4 in a tumor cell line. PMID: 17052796
- Phospholipid hydroperoxide glutathione peroxidase expression is downregulated in poorly differentiated breast invasive ductal carcinoma PMID: 17516241
- Results show the he crystal structure of the catalytically active U46C mutant of GPx4 and site-directed mutagenesis revealed amino acid residues important for catalysis and covalent protein polymerization. PMID: 17630701
- These data provide strong support for the hypothesis that common variation in GPX4 is associated with prognosis after a diagnosis of breast cancer. PMID: 17634480
- The GPX4c718t SNP both alters protein binding to the 3'UTR in vitro and influences the concentration of lymphocyte GPx4 and other selenoproteins in vivo PMID: 18400727
- No significant risk for GPX4 in colorectal adenoma. PMID: 18483336
- Short form Gpx4 protein is present in mitochondria and is essential for survival and protection against apoptosis, whereas the long form Gpx4 protein is important for male fertility. PMID: 19744930