Recombinant Human Phosphatidylinositol 4,5-Bisphosphate 3-Kinase Catalytic Subunit Gamma Isoform (PIK3CG) Protein (His&Myc)

Name: Recombinant Human Phosphatidylinositol 4,5-Bisphosphate 3-Kinase Catalytic Subunit Gamma Isoform (PIK3CG) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-01593P
Availability: InStock

Greater than 85% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Phosphatidylinositol 4,5-Bisphosphate 3-Kinase Catalytic Subunit Gamma Isoform (PIK3CG) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 85% as determined by SDS-PAGE.
Uniprotkb	P48736
Target Symbol	PIK3CG
Synonyms	PI3-kinase subunit gamma;PI3K-gamma;PI3Kgamma;PtdIns-3-kinase subunit gamma;Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma;PtdIns-3-kinase subunit p110-gamma;p110gamma;Phosphoinositide-3-kinase catalytic gamma polypeptide;Serine/threonine protein kinase PIK3CG (EC:2.7.11.1);p120-PI3K
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	IGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIE
Expression Range	828-1073aa
Protein Length	Partial
Mol. Weight	35.4 kDa
Research Area	Cancer
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Phosphoinositide-3-kinase (PI3K) that phosphorylates PtdIns(4,5)P2 (Phosphatidylinositol 4,5-bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Links G-protein coupled receptor activation to PIP3 production. Involved in immune, inflammatory and allergic responses. Modulates leukocyte chemotaxis to inflammatory sites and in response to chemoattractant agents. May control leukocyte polarization and migration by regulating the spatial accumulation of PIP3 and by regulating the organization of F-actin formation and integrin-based adhesion at the leading edge. Controls motility of dendritic cells. Together with PIK3CD is involved in natural killer (NK) cell development and migration towards the sites of inflammation. Participates in T-lymphocyte migration. Regulates T-lymphocyte proliferation and cytokine production. Together with PIK3CD participates in T-lymphocyte development. Required for B-lymphocyte development and signaling. Together with PIK3CD participates in neutrophil respiratory burst. Together with PIK3CD is involved in neutrophil chemotaxis and extravasation. Together with PIK3CB promotes platelet aggregation and thrombosis. Regulates alpha-IIb/beta-3 integrins (ITGA2B/ ITGB3) adhesive function in platelets downstream of P2Y12 through a lipid kinase activity-independent mechanism. May have also a lipid kinase activity-dependent function in platelet aggregation. Involved in endothelial progenitor cell migration. Negative regulator of cardiac contractility. Modulates cardiac contractility by anchoring protein kinase A (PKA) and PDE3B activation, reducing cAMP levels. Regulates cardiac contractility also by promoting beta-adrenergic receptor internalization by binding to GRK2 and by non-muscle tropomyosin phosphorylation. Also has serine/threonine protein kinase activity: both lipid and protein kinase activities are required for beta-adrenergic receptor endocytosis. May also have a scaffolding role in modulating cardiac contractility. Contributes to cardiac hypertrophy under pathological stress. Through simultaneous binding of PDE3B to RAPGEF3 and PIK3R6 is assembled in a signaling complex in which the PI3K gamma complex is activated by RAPGEF3 and which is involved in angiogenesis.
Subcellular Location	Cytoplasm. Cell membrane.
Protein Families	PI3/PI4-kinase family
Database References	HGNC: 8978 OMIM: 601232 KEGG: hsa:5294 STRING: 9606.ENSP00000352121 UniGene: PMID: 29666415 PIK3CG gene rs12667819 was shown to be associated with attention-deficit/hyperactivity disorder (ADHD) risk in dominant model, ADHD-I type, and symptom scores. Gene-environmental interactions analysis revealed potential interactions of rs12667819 collaborating with blood lead and feeding style to modify ADHD risk. Expression quantitative trait loci analysis suggested that rs12667819 may mediate PIK3CG gene expression. PMID: 29097255 Predicted activities were further evaluated through in-vitro testing of gallic acid and serpentine targeting PI3Kgamma. PMID: 28359246 we propose that the PKA-Smurf1-PIPKIgamma pathway has an important role in pulmonary tumorigenesis and imposes substantial clinical impact on development of novel diagnostic markers and therapeutic targets for lung cancer treatment. PMID: 28581524 A positive correlation may exist between PIK3CG single nucleotide polymorphisms and patients with poor responsiveness to clopidogrel. PMID: 28885323 PI3K, independently of protein kinase B, has a role in parasite-induced netosis. One of the main isoforms involved is PI3Kgamma which works in a reactive-oxygen-species-dependent way. PMID: 27154356 Diminished expression of p110gamma in pulmonary vascular endothelial cells of patients with acute respiratory distress syndrome suggests that impaired p110gamma-FoxM1 vascular repair signaling is a critical factor in persistent leaky lung microvessels in ARDS. PMID: 26839042 Findings suggest the pathophysiological role of phosphoinositide 3-kinase gamma (PI3Kgamma) in atherogenesis. PMID: 26658747 Our findings suggest that p84 binding to p110gamma may represent a novel negative feedback signal that terminates PI3Kgamma activity. PMID: 25753393 findings suggest that miR-502 functions as a tumor suppressor in HCC via inhibition of PI3KCG, supporting its utility as a promising therapeutic gene target for this tumor type PMID: 26163264 PI3Kgamma plays an important role in the development of eosinophilic inflammation a PMID: 24333185 PI3Kgamma-induced VEGF expression was reduced when the human tocopherol-associated protein 1 (hTAP1/SEC14L2) was overexpressed suggesting formation of an inactive PI3Kgamma/hTAP1 heterodimer. PMID: 25290554 data argue for differential regulatory functions of the non-catalytic subunits and a specific Gbetagamma-dependent regulation of p101 in PI3Kgamma activation. PMID: 26173259 The interaction between PI3Kgamma and CNGA1 does not appear to play a role in regulation of CNG channel activity, but PI3Kgamma uses CNGA1 as an anchoring module to achieve close proximity to its substrate to generate D3-phosphoinositides PMID: 25644171 Mfng is an oncogene acting through Notch-mediated induction of Pik3cg. PMID: 25808869 increased susceptibility of individuals with COPD to influenza likely results from impaired antiviral responses, which are mediated by increased PI3K-p110alpha activity. PMID: 25751541 Data indicate class of benzothiazoles as inhibitors of phosphoinositide 3-kinase gamma. PMID: 24754609 phosphatidylinositol 3-kinase gamma has a role in insulin secretion induced by glucose-dependent insulinotropic polypeptide PMID: 25288806 The data indicate that PI3Kgamma has a critical role in cAMP-mediated inflammatory hypernociception and analgesic signalling via mu-opioid receptors and PI3K/Akt in neuronal cells. PMID: 24654606 Binding of the HSV-1 envelope initiates the epidermal growth factor receptor EGFR-PI3K signaling pathway, which leads to virus-induced early cofilin phosphorylation and F-actin polymerization. PMID: 24425731 Ablating the interaction of PI3Kgamma with Gbetagamma heterodimers attenuates signaling, chemotaxis, and transformation driven by a GPCR agonist in cell lines. PMID: 24190998 Class II enzyme PI3K-C2beta and class IB isozyme p110gamma mainly regulate the S1P- and high density lipoprotein (HDL)-dependent endothelial cell (EC) migration and PI3K-C2alpha primarily controls EC survival PMID: 23320105 Assessed the expression of class I PI3K p110 isoforms in idiopathic pulmonary fibrosis lung tissue as well as in tissue-derived fibroblast cell lines. PMID: 23439433 kinase-independent function of PI3Kgamma could directly inhibit GSK-3 function by preventing the PP2A-PPMT-1 interaction and that this inhibition of GSK-3 was independent of Akt. PMID: 23354687 Upregulated phosphoinositide 3-kinase gamma is a target to suppress breast cancer cell migration and invasion. PMID: 23500535 PI3Kgamma plays a key role in ipopolysaccharide-induced ROS generation in alveolar epithelial cells, thereby activating NF-kappaB PMID: 22825625 Culturing spermatogonia in vitro at 37 degrees C could inhibit the expression of PI3K and c-kit, and lead to the mutation of the c-kit gene. PMID: 22568210 The expression levels of PI3K protein and mRNA in esophageal squamous cell carcinoma tissues are significantly increased and PI3K plays a role in the carcinogenesis and development of ESCC. PMID: 22325219 a novel mechanism that links PI3Kgamma activity with chemotaxis and superoxide production in G-protein coupled receptor signaling. PMID: 22573891 PI3K might play a role in silica-induced DNA double strand break repair by regulating the expression levels of Ku70 and Ku80 in lung fibroblasts. PMID: 20465946 findings suggest that PIK3CG function impacts the severity of the intraparenchymal bleed in patients with intracerebral hemorrhage PMID: 22449554 role of p110gamma as a promoter of HCC proliferation and unveil an important cell cycle regulation function of this molecule. PMID: 21796621 A novel regulatory role of p101 in the activation of PI3Kgamma. PMID: 22054284 Ras-p110gamma interaction is necessary for efficient beta-selection-promoted proliferation but is dispensable for the survival or differentiation of thymocytes. PMID: 21930962 protection from insulin resistance, metabolic inflammation, and fatty liver in mice lacking functional PI3Kgamma is largely consequent to their leaner phenotype PMID: 21949398 Data show 5-HT can induce activation of two interrelated signaling pathways, Erk1/2 and PI3K/Akt to induce proliferation, migration, and differentiation. PMID: 19926313 Activation of the PI3K/Akt/mTOR pathway correlates with tumour progression and reduced survival in patients with urothelial carcinoma of the urinary bladder. PMID: 21707707 Once activated, p110gamma promotes inside-out activation of a single integrin, alpha4beta1, causing myeloid cell invasion into tumors. PMID: 21665146 PI3Kgamma, a PI3K isoform exhibiting restricted tissue distribution, is strictly required for signaling from the KSHV-encoded vGPCR oncogene to Akt/mTOR. PMID: 21665152 Data demonstrate that AG/UAG attenuation of ISO-induced lipolysis involves PI3Kgamma/AKT and PDE3B. PMID: 21435395 p110gamma anchors protein kinase A (PKA) through a site in its N-terminal region. Anchored PKA activates PDE3B to enhance cAMP degradation and phosphorylates p110gamma to inhibit PIP(3) production PMID: 21474070 C. jejuni activates a PI3K/Akt-dependent anti-inflammatory pathway in human intestinal epithelial cells. PMID: 20863633 Data indicate that stathmin is a target of the PI3K/Akt pathway in cervical cancer cells. PMID: 20657188 Platelet migration was stimulated by SDF-1 through PI3 kinase dependent mechanism. PMID: 20852838 This indicates that not only MAPK activation, but PI3Kgamma protein kinase activity in general is localized in the cytosol. PMID: 21185806 Studies indicate that targeting the deregulated PI3K/PTEN-Akt signaling axis has currently emerged as one of the major tenets in anticancer drug development. PMID: 20622047 PI3K-PDK1 signaling is essential for viability, MALT1 protease activity, and NF-kappaB activation in activated B-cell-like diffuse large B-cell lymphoma cells that carry mutations in the BCR proximal signaling adaptor CD79B. PMID: 21173233 Data demonstrate that PI3K/Akt pathway regulates the expression of DNMT3B at transcriptional and post-transcriptional levels, which is particularly important to understand the effects of PI3K/Akt and DNMT3B on hepatocarcinogenesis. PMID: 20506537 Data show an in vitro link between phosphoinositide 3-kinase-mediated HOXA9/HOXA10 expression, and a drug-resistant, progenitor cell phenotype in MGMT-independent pediatric glioblastoma. PMID: 20935218 Findings show that oncogenic factors activating the phosphoinositide 3-kinase/Akt pathway can regulate alternative splicing of Casp9 via a coordinated mechanism involving the phosphorylation of SRp30a. PMID: 21045158

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.