Recombinant Human Peroxisome Proliferator-Activated Receptor Gamma Coactivator 1-Beta (PPARGC1B) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-06551P

Greater than 90% as determined by SDS-PAGE.
Recombinant Human Peroxisome Proliferator-Activated Receptor Gamma Coactivator 1-Beta (PPARGC1B) Protein (His&Myc)
Beta LifeScience
SKU/CAT #: BLC-06551P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Peroxisome Proliferator-Activated Receptor Gamma Coactivator 1-Beta (PPARGC1B) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Uniprotkb | Q86YN6 |
Target Symbol | PPARGC1B |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-10His&C-Myc |
Target Protein Sequence | TRRNFRCESRGPCSDRTPSIRHARKRREKAIGEGRVVYIQNLSSDMSSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH |
Expression Range | 868-1023aa |
Protein Length | Partial |
Mol. Weight | 25.6 kDa |
Research Area | Others |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Plays a role of stimulator of transcription factors and nuclear receptors activities. Activates transcriptional activity of estrogen receptor alpha, nuclear respiratory factor 1 (NRF1) and glucocorticoid receptor in the presence of glucocorticoids. May play a role in constitutive non-adrenergic-mediated mitochondrial biogenesis as suggested by increased basal oxygen consumption and mitochondrial number when overexpressed. May be involved in fat oxidation and non-oxidative glucose metabolism and in the regulation of energy expenditure. Induces the expression of PERM1 in the skeletal muscle in an ESRRA-dependent manner. |
Subcellular Location | Nucleus. |
Database References | HGNC: 30022 OMIM: 608886 KEGG: hsa:133522 STRING: 9606.ENSP00000312649 UniGene: PMID: 29916549 |