Recombinant Human Peroxisome Proliferator-Activated Receptor Gamma Coactivator 1-Beta (PPARGC1B) Protein (His&Myc)

Name: Recombinant Human Peroxisome Proliferator-Activated Receptor Gamma Coactivator 1-Beta (PPARGC1B) Protein (His&Myc)
Brand: Beta LifeScience
SKU: BLC-06551P
Availability: InStock

Greater than 90% as determined by SDS-PAGE.

Collections: All products, High-quality recombinant proteins, Other recombinant proteins

Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description	Recombinant Human Peroxisome Proliferator-Activated Receptor Gamma Coactivator 1-Beta (PPARGC1B) Protein (His&Myc) is produced by our E.coli expression system. This is a protein fragment.
Purity	Greater than 90% as determined by SDS-PAGE.
Uniprotkb	Q86YN6
Target Symbol	PPARGC1B
Species	Homo sapiens (Human)
Expression System	E.coli
Tag	N-10His&C-Myc
Target Protein Sequence	TRRNFRCESRGPCSDRTPSIRHARKRREKAIGEGRVVYIQNLSSDMSSRELKRRFEVFGEIEECEVLTRNRRGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSKYEAMDFDSLLKEAQQSLH
Expression Range	868-1023aa
Protein Length	Partial
Mol. Weight	25.6 kDa
Research Area	Others
Form	Liquid or Lyophilized powder
Buffer	Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%.
Storage	1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function	Plays a role of stimulator of transcription factors and nuclear receptors activities. Activates transcriptional activity of estrogen receptor alpha, nuclear respiratory factor 1 (NRF1) and glucocorticoid receptor in the presence of glucocorticoids. May play a role in constitutive non-adrenergic-mediated mitochondrial biogenesis as suggested by increased basal oxygen consumption and mitochondrial number when overexpressed. May be involved in fat oxidation and non-oxidative glucose metabolism and in the regulation of energy expenditure. Induces the expression of PERM1 in the skeletal muscle in an ESRRA-dependent manner.
Subcellular Location	Nucleus.
Database References	HGNC: 30022 OMIM: 608886 KEGG: hsa:133522 STRING: 9606.ENSP00000312649 UniGene: PMID: 29916549 Incrementally paced murine Pgc1beta(-/-) hearts show pro-arrhythmic atrial phenotypes that are age dependent. PMID: 28960529 Insulin-like growth factor 1 receptor, associate of Myc 1, and peroxisome proliferator-activated receptor gamma coactivator 1beta are direct targets of miR-139 PMID: 26868851 Study provides evidence that PGC1beta rs32579 was associated with nevus count, and both melanoma risk and mortality, which further emphasizes the critical role of PGC1s in multiple steps of melanocyte formation and melanoma development. PMID: 28542949 The presence of the PPARGC1B (Ala203Pro) SNP did not modify the association between inorganic arsenic methylation capacity and breast cancer. PMID: 27557380 Genetic variants of PPARGC1B are significantly associated with gout, and a missense single nucleotide polymorphism, rs45520937, augments NLRP3 and IL-1beta expression PMID: 28394398 the forkhead box O3 (FOXO3)/liver kinase B1 (LKB1)/AMP-activated protein kinase/peroxisome proliferator-activated receptor-gamma co-activator-1beta (PGC-1beta)/pyruvate dehydrogenase-A1 pathway is essential for CD44 expression and cancer stem cells properties. PMID: 28507102 We also suggest a novel hepatic protective role of PGC1B as a modulator of E2 effects on mitochondrial biogenesis PMID: 27885055 we show an association of HER2-overexpression and PGC-1beta. PGC-1beta knockdown impairs HER2-overexpressing cells proliferation acting on ERRalpha signaling, metabolism, and redox balance. PMID: 26602383 Further replication study confirmed the association signals of rs4705372 (P = 0.0026) and rs11743128 (P = 0.0387) in the independent validation sample. Our study results suggest that PPARGC1B is a novel susceptibility gene of Kashin-Beck disease . PMID: 27108113 Human influenza hemagglutinin-tagged PPARGC1B coprecipitated more intensely with ERalpha in the +102525A than the +102525G construct after 17beta estradiol treatment PMID: 27027322 Data suggest that PGC-1alpha and PGC-1beta could play a role in regulating retina cell survival, and may be therapeutic targets to prevent retinal degeneration. PMID: 26427438 PGC-1(beta) and estrogen-related receptor alpha are aberrantly expressed in human colon cell lines and tumors. PMID: 26351140 RUNX3 is related to both the severity of AS and the function of daily life. PPARGC1B is related to the function of daily life. PMID: 25494292 Data show that PGC-1beta protein mediated the expression of proinflammatory cytokines and apoptosis through extracellular signal-regulated kinase (ERK), p38 and NF-kappaB in rheumatoid arthritis fibroblast-like synoviocytes. PMID: 25367151 Variation in the PPARGC1B gene may be associated with type 2 diabetes among middle-aged Chinese men and women. PMID: 24359475 cell apoptosis is orchestrated by the balance between several signaling pathways, and PGC-1beta takes part in these events in breast cancer cells mediated by the mTOR signaling pathway. PMID: 23877360 PPARgamma and PPARGC1B polymorphisms modulate the association between phthalate exposure and BC risk PMID: 23866026 DNA polymorphisms of PPARGC1B, coding a bona fide ER co-activator, are associated with ER-positive breast cancer risk. PMID: 21269472 PGC-1b, a coactivator of both LXR-alpha and SREBP-1, was markedly down-regulated by OEPAs compared with EPA. PMID: 23680128 PPARGC1B is associated with the susceptibility to ankylosing spondylitis in the Chinese Han population. PMID: 23637848 PGC-1beta mediates adaptive chemoresistance to cisplatin associated with mitochondrial DNA mutations in non-small-cell lung cancer cells. PMID: 22777349 Peroxisome proliferator-activated receptor gamma coactivator 1beta (PGC-1beta) protein attenuates vascular lesion formation by inhibition of chromatin loading of minichromosome maintenance complex in smooth muscle cells PMID: 23264620 Inhibition of PGC-1a and PGC-1b blocks the alpha-MSH-mediated induction of MITF and melanogenic genes. PMID: 23201126 Absence of PGC-1 proteins accelerated the transition to heart failure following pressure overload. PMID: 22939990 Acetyl-L-carnitine activates the peroxisome proliferator-activated receptor-gamma coactivators PGC-1alpha/PGC-1beta-dependent signaling cascade of mitochondrial biogenesis and decreases the oxidized peroxiredoxins content in old rat liver PMID: 22533417 Polymorphisms of -427C>T on the promoter and those of +102525G>A on exon 5 of the PPARGC1B gene may affect the development of AHR through the modulation of PPARGC1B gene products. PMID: 21692888 Exercise can activate an upstream promoter in humans and support AMPK as a major regulator of transcripts from the canonical PGC-1alpha promoter and the involvement of beta-adrenergic stimulation in combination with AMPK in the regulation of PGC-1alpha-b. PMID: 21862727 PGC-1beta is a potent regulator of angiogenesis, thus providing a novel link between the regulations of oxidative metabolism and vascular density. PMID: 21364124 Data show that mitogen-activated protein kinase kinases direct mitochondrial biogenesis by selectively inducing PGC-1beta expression. PMID: 21458501 physiological role of PGC-1beta: investigation of mitochondrial homeostasis regulatory pathway involving PGC-1beta and PI3K; investigation of regulation of PGC-1beta gene expression PMID: 21054343 miR-378( *) inhibits the expression of two PGC-1beta partners, ERRgamma and GABPA, leading to a reduction in TCA cycle gene expression and oxygen consumption as well as an increase in lactate production and in cell proliferation PMID: 20889127 Taken together, these results confirm the direct interaction of NRF-1 and ERR alpha with PGC-1 beta, and their participation in mitochondrial biogenesis and respiration. PMID: 20561910 the PPARGC1B gene Ala203Pro polymorphism is associated with physical performance of athletes. PMID: 20058823 The PGC-1-related protein PERC is a selective coactivator of estrogen receptor alpha PMID: 11854298 role in coactivating the cardiac-enriched nuclear receptors estrogen-related receptor-alpha and -gamma PMID: 12181319 role in activating orphan nuclear constitutive androstane receptor PMID: 12551939 Variation of PGC-1beta may contribute to the pathogenesis of obesity, with a widespread Ala203 allele being a risk factor for the development of this common disorder. PMID: 15863669 fatty acids differentially regulated expression of the genes encoding the PGC-1B isoform PMID: 16132959 PPARGC1A, PPARGC1B, and EP300 may have roles for familial breast cancer susceptibility PMID: 16704985 Acute elevation of plasma non-esterified fatty acd levels downregulates PPARGC1A, PPARGC1B and PPARA expression. PMID: 16896940 Recent studies have elucidated the function of the PGC-1 coactivators in different tissues and have highlighted the implications of PGC-1 dysregulation in diseases such as diabetes, obesity, cardiomyopathy, or neurodegeneration. PMID: 17018837 Upregulation of PGC-1alpha and PGC-1beta in the colorectal tumor cells can be part of an adaptation mechanism to help overcome the severe consequences of mtDNA mutations on oxidative phosphorylation. PMID: 17341490 Study suggests that young carriers of a PGC-1beta 203Pro allele have enhanced insulin-stimulated glucose metabolism and may be protected against an age-related decline in PGC-1beta expression in muscle. PMID: 17579828 training caused a decrease in PGC-1beta mRNA levels. PMID: 17690194 A novel role of PGC-1beta in mitochondrial physiology, namely the control of mitochondrial fusion mainly through Mfn2. PMID: 18974884 the association of the 482G/A polymorphism of the PGC-1alpha gene with type 2 diabetes and the quantitative and qualitative binding force changes between the PGC-1alpha domain mutant and MEF2C PMID: 19065516 PGC-1alpha and PGC-1beta expression improved mitochondrial respiration in cells from patients with mitochondrial disorders. PMID: 19297390 PGC-1beta is a substrate for general control of amino-acid synthesis (GCN5) and is acetylated on at least 10 lysine residues that are distributed along multiple domains of the protein. PMID: 19491097

FAQs

Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.