Recombinant Human Peroxisome Proliferator-Activated Receptor Delta (PPARD) Protein (His)

Beta LifeScience SKU/CAT #: BLC-05093P
Greater than 85% as determined by SDS-PAGE.
Greater than 85% as determined by SDS-PAGE.

Recombinant Human Peroxisome Proliferator-Activated Receptor Delta (PPARD) Protein (His)

Beta LifeScience SKU/CAT #: BLC-05093P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.

Submit an inquiry today to inquire about all available size options and prices! Connect with us via the live chat in the bottom corner to receive immediate assistance.

Product Overview

Description Recombinant Human Peroxisome Proliferator-Activated Receptor Delta (PPARD) Protein (His) is produced by our E.coli expression system. This is a protein fragment.
Purity Greater than 85% as determined by SDS-PAGE.
Uniprotkb Q03181
Target Symbol PPARD
Synonyms FAAR; MGC3931; NR1C2; NUC1; NUCI; NUCII; Nuclear hormone receptor 1; Nuclear receptor subfamily 1 group C member 2; Peroxisome proliferative activated receptor delta; Peroxisome proliferator-activated receptor beta (PPAR-beta); Peroxisome proliferator-activated receptor beta; Peroxisome proliferator-activated receptor delta; PPAR beta; PPAR-beta; PPAR-delta; PPARB; ppard; PPARD_HUMAN
Species Homo sapiens (Human)
Expression System E.coli
Tag N-6His
Target Protein Sequence QVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
Expression Range 171-441aa
Protein Length Partial
Mol. Weight 35.1 kDa
Research Area Cardiovascular
Form Liquid or Lyophilized powder
Buffer Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Target Details

Target Function Ligand-activated transcription factor. Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty acids, such as gamma-linoleic acid and eicosapentanoic acid. Once activated by a ligand, the receptor binds to promoter elements of target genes. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the acyl-CoA oxidase gene. Decreases expression of NPC1L1 once activated by a ligand.
Subcellular Location Nucleus.
Protein Families Nuclear hormone receptor family, NR1 subfamily
Database References

HGNC: 9235

OMIM: 600409

KEGG: hsa:5467

STRING: 9606.ENSP00000310928

UniGene: PMID: 12009300

  • 4 polymorphisms were found: -409C/T (promoter, +73C/T (exon 1), +255A/G (exon 3), & +294T/C (exon 4). An interaction with the PPAR alpha L162V polymorphism was also detected for several lipid parameters. PPARD plays a role in cholesterol metabolism. PMID: 12615676
  • The 15-lipoxygenase-1 product 13-S-hydroxyoctadecadienoic acid down-regulates PPAR-delta to induce apoptosis in colorectal cancer cells. PMID: 12909723
  • results implicate PPAR-delta in the regulation of intestinal adenoma growth PMID: 14758356
  • Positive associations of PPAR-delta polymorphisms with fasting plasma glucose and BMI detected in nondiabetic control subjects PMID: 14988273
  • gene regulation by PPARdelta in the uterine cells uniquely responds to SRC-2, N-CoR, SMRT, or RIP140, and these interactions may be operative during implantation when these cofactors are abundantly expressed. PMID: 15001550
  • PPAR-beta/delta activation stimulates keratinocyte differentiation, is anti-inflammatory, improves barrier homeostasis, and stimulates triglyceride accumulation in keratinocytes. PMID: 15102088
  • 11beta-HSD2 is an additional target for PPAR delta, which may regulate human placental function PMID: 15591138
  • This study was performed to determine whether specific activation of PPARdelta has direct effects on insulin action in skeletal muscle. PMID: 15793256
  • COX-2 immunopositivity was significantly associated with PPARbeta and PPARgamma immunoreactivity. Microvessel density was significantly higher among PPARbeta-immunoreactive squamous cell carcinomas. PMID: 15811118
  • PPARdelta signaling pathways are interconnected at the level of cross-regulation of their respective transcription factor mRNA levels PMID: 15890193
  • PPARdelta expression is up-regulated between the first and third trimester, indicating a role for this nuclear receptor in placental function PMID: 15979543
  • PPARdelta + 294T/C gene polymorphism in subjects with metabolic syndrome may be involved in the occurrence of obesity and dyslipidemia. PMID: 16053787
  • PPARdelta partially rescued prostate epithelial cells from growth inhibition and also dramatically inhibited sulindac sulfide-mediated p21WAF1/CIP1 upregulation. PMID: 16091736
  • PPARdelta +294T/C polymorphism has no influence on plasma lipoprotein concentrations, body mass index or atherosclerotic disease either in healthy subjects or in patients with DM-2, both in males and females. PMID: 16285997
  • Single nucleotide polymorphisms of PPARD primarily affected insulin sensitivity by modifying glucose uptake in skeletal muscle but not in adipose tissue. PMID: 16306381
  • The expression of PPARdelta gene in rectal cancers is not statistically different from normal mucosa. PMID: 16361076
  • Human platelets contain PPARbeta and that its selective activation inhibits platelet aggregation. PMID: 16368717
  • Data describe the activated form of the peroxisome proliferator-activated receptor-beta/delta using a ligand binding domain model. PMID: 16387648
  • This review concludes that PPAR delta has emerged as a powerful metabolic regulator in diverse tissues including fat, skeletal muscle, and the heart. PMID: 16511591
  • PGI2 protects endothelial cells from H2O2-induced apoptosis by inducing PPARdelta binding to 14-3-3alpha promoter, thereby upregulating 14-3-3alpha protein expression. PMID: 16645156
  • data provide further evidence for an involvement of PPARdelta in the regulation of BMI. PMID: 16652134
  • Skeletal muscle mRNA expression of PPAR delta increased in type 2 diabetic patients with an improved clinical profile following low-intensity exercise, but were unchanged in patients who did not show exercise-mediated improvements in clinical parameters. PMID: 16752430
  • Single nucleotide polymorphisms in PPARD modify the conversion from glucose intolerance to type 2 diabetes. PMID: 16804087
  • Therefore, these results indicate that induction of fatty acid oxidation with PPARbeta activators during short-term exposition is not sufficient to correct for insulin resistance in muscle cells from type 2 diabetic patients. PMID: 16897074
  • PPARbeta/delta is a novel regulator of endothelial cell proliferation and angiogenesis through VEGF. PMID: 17068288
  • PPARD-87T/C polymorphism is associated with higher fasting plasma glucose concentrations in both normal glucose tolerant and diabetic subjects, largely due to impaired insulin sensitivity PMID: 17116180
  • PPAR-delta activation increases cholesterol export and represses inflammatory gene expression in macrophages and atherosclerotic lesions. PMID: 17119917
  • support the rationale for developing PPARdelta antagonists for prevention and/or treatment of cancer PMID: 17148604
  • These studies demonstrate that ligand activation of PPARbeta/delta does not lead to an anti-apoptotic effect in either human or mouse keratinocytes, but rather, leads to inhibition of cell growth likely through the induction of terminal differentiation. PMID: 17254750
  • DNA sequence variation in the PPARdelta locus is a potential modifier of changes in cardiorespiratory fitness and plasma HDL-C in healthy individuals in response to regular exercise. PMID: 17259439
  • Low PPARD expression is associated with Prostate Cancer Growth. PMID: 29187400
  • Study demonstrates that oleanolic acid, as a natural product, can ameliorate the high glucose-triggered endothelial function by activating the nuclear receptor PPARdelta. PMID: 28067284
  • PPARD rs7770619 is a novel candidate variant for impaired fasting glucose and type 2 diabetes and shows association with malondialdehyde levels. PMID: 29776318
  • The negative responders for aerobic training are carriers of the PPARD rs2267668 G allele. The best responders to aerobic training are PPARD rs1053049 TT and rs2267668 AA. PMID: 29762540
  • The current results suggest that A/A carriers of PPAR-delta SNP (rs2267668) may enjoy fewer beneficial effects of exercise-centered lifestyle intervention on anthropometric indices and blood measurements. PMID: 29494521
  • Polymorphism of PPARD is associated with late onset of type 2 diabetes mellitus. PMID: 28292576
  • findings suggest that PPARdelta conditions CLL cells to survive in harsh microenvironmental conditions by reducing oxidative stress and increasing metabolic efficiency. PMID: 28050012
  • Here, theauthors describe a novel PPARbeta/delta-dependent molecular cascade involving TGFbeta1 and miR-21-3p, which is activated in the epidermis in response to UV exposure. PMID: 27250636
  • findings identified previously unrecognized role of IP-PPARdelta signal transduction pathway in the production of sAPPalpha in cerebral microvasculature. PMID: 26661245
  • the metabolic events, controlled by PPARs, occurring during neuronal precursor differentiation, the glucose and lipid metabolism was investigated. PMID: 27860527
  • PPAR-delta activation prevents in-stent restenosis and stent thrombosis. PMID: 27283742
  • findings identify LPCAT3 as a direct PPARdelta target gene and suggest a novel function of PPARdelta in regulation of phospholipid metabolism through LPCAT3. PMID: 27913621
  • The minor allele of rs2016520 and rs9794 in PPAR-delta and interaction between rs2016520 and non-smoking were associated with decreased risk of CVD. PMID: 28287878
  • a novel SNP x SNP interaction between rs2267668 in PPARdelta and rs7191411 in EMP2 that has significant impact on circulating HDL-C levels in the Singaporean Chinese population. PMID: 27530449
  • Results indicate that PPARdelta-mediated downregulation of Nox4 modulates cellular redox status, which in turn plays a critical role in extracellular matrix homeostasis through ROS-dependent regulation of MMP-2 activity. PMID: 26403493
  • The PPAR-beta role in neuroblastoma cell tumorigenesis and differentiation PMID: 27996177
  • These observations candidate PPARs as new biomarkers of follicle competence opening new hypotheses on controlled ovarian stimulation effects on ovarian physiology. PMID: 26332656
  • The PPAR delta role in neuroblastoma cell tumorigenesis and differentiation PMID: 27996177
  • PPARdelta activation may be a potential risk of atherosclerosis through enhancing activity of SMS2 PMID: 27278004

    • FAQs

    Please fill out the Online Inquiry form located on the product page. Key product information has been pre-populated. You may also email your questions and inquiry requests to sales1@betalifesci.com. We will do our best to get back to you within 4 business hours.

    Feel free to use the Chat function to initiate a live chat. Our customer representative can provide you with a quote immediately.

    Proteins are sensitive to heat, and freeze-drying can preserve the activity of the majority of proteins. It improves protein stability, extends storage time, and reduces shipping costs. However, freeze-drying can also lead to the loss of the active portion of the protein and cause aggregation and denaturation issues. Nonetheless, these adverse effects can be minimized by incorporating protective agents such as stabilizers, additives, and excipients, and by carefully controlling various lyophilization conditions.

    Commonly used protectant include saccharides, polyols, polymers, surfactants, some proteins and amino acids etc. We usually add 8% (mass ratio by volume) of trehalose and mannitol as lyoprotectant. Trehalose can significantly prevent the alter of the protein secondary structure, the extension and aggregation of proteins during freeze-drying process; mannitol is also a universal applied protectant and fillers, which can reduce the aggregation of certain proteins after lyophilization.

    Our protein products do not contain carrier protein or other additives (such as bovine serum albumin (BSA), human serum albumin (HSA) and sucrose, etc., and when lyophilized with the solution with the lowest salt content, they often cannot form A white grid structure, but a small amount of protein is deposited in the tube during the freeze-drying process, forming a thin or invisible transparent protein layer.

    Reminder: Before opening the tube cap, we recommend that you quickly centrifuge for 20-30 seconds in a small centrifuge, so that the protein attached to the tube cap or the tube wall can be aggregated at the bottom of the tube. Our quality control procedures ensure that each tube contains the correct amount of protein, and although sometimes you can't see the protein powder, the amount of protein in the tube is still very precise.

    To learn more about how to properly dissolve the lyophilized recombinant protein, please visit Lyophilization FAQs.

    More from All Products
    Tn5 Transposase
    • Expression system: E.coli;
    CAT#: TN5-BL01
    Sale
    SDS-PAGE analysis of Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein, CAT# BLT-08873P showing >85% purity under 15% SDS-PAGE (Reduced)
    Human SHFL (Shiftless Antiviral Inhibitor Of Ribosomal Frameshifting Protein) - Recombinant Protein
    • Molecule: SHFL;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+sumo;
    • Sequence: 1-291;
    CAT#: BLT-08873P

    Save $50
    Sale
    SDS-PAGE analysis of Human SFTPA1 (Pulmonary Surfactant-Associated Protein A1) - Recombinant Protein, CAT# BLT-08790P showing >90% purity under 15% SDS-PAGE (Reduced)
    Human SFTPA1 (Pulmonary Surfactant-Associated Protein A1) - Recombinant Protein
    • Molecule: SFTPA1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 21-248;
    CAT#: BLT-08790P

    Save $50
    Sale
    SDS-PAGE analysis of Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein, CAT# BLT-08789P showing >90% purity under 15% SDS-PAGE (Reduced)
    Human SFTPA2 (Pulmonary Surfactant-Associated Protein A2) - Recombinant Protein
    • Molecule: SFTPA2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 21-248;
    CAT#: BLT-08789P

    Save $50
    Sale
    SDS-PAGE analysis of Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein, CAT# BLT-08321P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NDUFV1 (Nadh Dehydrogenase [Ubiquinone] Flavoprotein 1, Mitochondrial) - Recombinant Protein
    • Molecule: NDUFV1;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His+SUMO;
    • Sequence: 21-464aa;
    CAT#: BLT-08321P

    Save $50
    Sale
    SDS-PAGE analysis of Human NEU2 (Sialidase-2) - Recombinant Protein, CAT# BLT-08142P, showing >90% purity under 15% SDS-PAGE (Reduced)
    Human NEU2 (Sialidase-2) - Recombinant Protein
    • Molecule: NEU2;
    • Species: Human;
    • Expression system: E.coli;
    • Tag: N-6His;
    • Sequence: 1-380aa;
    CAT#: BLT-08142P

    Save $50
    Recently viewed