Recombinant Human Peroxiredoxin-1 (PRDX1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-02149P

Greater than 85% as determined by SDS-PAGE.
Recombinant Human Peroxiredoxin-1 (PRDX1) Protein (His)
Beta LifeScience
SKU/CAT #: BLC-02149P
Our products are highly customizable to meet your specific needs. You can choose options such as endotoxin removal, liquid or lyophilized forms, preferred tags, and the desired functional sequence range for proteins. Submitting a written inquiry expedites the quoting process.
Product Overview
Description | Recombinant Human Peroxiredoxin-1 (PRDX1) Protein (His) is produced by our E.coli expression system. This is a full length protein. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Uniprotkb | Q06830 |
Target Symbol | PRDX1 |
Synonyms | Heme binding 23 kDa protein; MSP23; Natural killer cell-enhancing factor A; NKEF A; NKEF-A; NKEFA; OSF3; Osteoblast specific factor 3; PAG; Paga; PAGB; Peroxiredoxin 1; Peroxiredoxin-1; PRDX1; PRDX1_HUMAN; Proliferation associated gene A ; Proliferation-associated gene protein; PRX1; PrxI; TDPX2; Thioredoxin peroxidase 2; Thioredoxin-dependent peroxide reductase 2 |
Species | Homo sapiens (Human) |
Expression System | E.coli |
Tag | N-6His |
Target Protein Sequence | MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK |
Expression Range | 1-199aa |
Protein Length | Full Length |
Mol. Weight | 27.6 kDa |
Research Area | Cardiovascular |
Form | Liquid or Lyophilized powder |
Buffer | Liquid form: default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Lyophilized powder form: the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | Briefly centrifuged the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. The default final concentration of glycerol is 50%. |
Storage | 1. Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. 2. Avoid repeated freeze-thaw cycles. 3. Store working aliquots at 4°C for up to one week. 4. In general, protein in liquid form is stable for up to 6 months at -20°C/-80°C. Protein in lyophilized powder form is stable for up to 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Target Details
Target Function | Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation. |
Subcellular Location | Cytoplasm. Melanosome. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV. |
Protein Families | Peroxiredoxin family, AhpC/Prx1 subfamily |
Database References | HGNC: 9352 OMIM: 176763 KEGG: hsa:5052 STRING: 9606.ENSP00000262746 UniGene: PMID: 29063384 |